Rabbit Polyclonal Anti-LMNB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LMNB1 |
Rabbit Polyclonal Anti-LMNB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LMNB1 |
Rabbit polyclonal anti-Lamin B1 antibody, Loading control
Applications | ChIP, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human LMNB1 |
Goat Anti-Lamin B1 (aa526-537) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DVKVILKNSQGE, from the internal region (near C terminus) of the protein sequence according to NP_005564.1; NP_001185486.1. |
Lamin B1 (LMNB1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of human Lamin B |
Lamin B1 (LMNB1) mouse monoclonal antibody, clone X223, Purified
Applications | IF, IHC, WB |
Reactivities | Bovine, Fish, Human, Mouse, Rat, Xenopus |
Lamin B1 (LMNB1) (107-186) mouse monoclonal antibody, clone 4E4, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
Lamin B1 (LMNB1) (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 459-488 amino acids from the C-terminal region of Human Lamin B1. |
Lamin B1 (LMNB1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal antibody to Lamin B1 (lamin B1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 289 and 574 of Lamin B1 (Uniprot ID#P20700) |
Rabbit polyclonal anti-Lamin B1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 572 of mouse Lamin B1 |
Rabbit Polyclonal Anti-LMNB1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LMNB1 antibody: synthetic peptide directed towards the middle region of human LMNB1. Synthetic peptide located within the following region: EEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM |
Rabbit anti Lamin B Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LMNB1 mouse monoclonal antibody,clone OTI5H9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LMNB1 mouse monoclonal antibody,clone OTI6E12
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LMNB1 mouse monoclonal antibody,clone OTI3D6
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
LMNB1 Antibody - middle region
Applications | WB |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse LMNB1 |
LMNB1 rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LMNB1 |
Lamin B1 Rabbit polyclonal Antibody
Applications | IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human Lamin B1 |
Modifications | Unmodified |
Lamin B1 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human Lamin B1 |
Lamin B1 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human Lamin B1 . |
LMNB1 mouse monoclonal antibody,clone OTI5H9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
LMNB1 mouse monoclonal antibody,clone OTI5H9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
LMNB1 mouse monoclonal antibody,clone OTI6E12
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
LMNB1 mouse monoclonal antibody,clone OTI6E12
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
LMNB1 mouse monoclonal antibody,clone OTI3D6
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
LMNB1 mouse monoclonal antibody,clone OTI3D6
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |