Rabbit Polyclonal Anti-MXD3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MXD3 antibody: synthetic peptide directed towards the N terminal of human MXD3. Synthetic peptide located within the following region: MEPLASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQ |
Rabbit Polyclonal Anti-MXD3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MXD3 antibody is: synthetic peptide directed towards the C-terminal region of Human MXD3. Synthetic peptide located within the following region: RLRADSLDSSGLSSERSDSDQEELEVDVESLVFGGEAELLRGFVAGQEHS |
MAD3 (MXD3) (C-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Human |
| Immunogen | Synthetic peptide from the C-Terminus of Human MAD3 (NP_112590.1) |
MAD3 (MXD3) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 27-56aa) of human MAD3 |
Rabbit Polyclonal anti-MXD3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MXD3 antibody: synthetic peptide directed towards the N terminal of human MXD3. Synthetic peptide located within the following region: PIHRRKKRPPQAPGAQDSGRSVHNELEKRRRAQLKRCLERLKQQMPLGAD |
Germany
Japan
United Kingdom
China