Rabbit polyclonal NEU2 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NEU2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 23-50 amino acids from the N-terminal region of human NEU2. |
Rabbit polyclonal Neuraminidase antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 110-124 of Human Neu2. |
Rabbit Polyclonal Anti-NEU2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NEU2 antibody is: synthetic peptide directed towards the N-terminal region of Human NEU2. Synthetic peptide located within the following region: ANVTRLCQVTSTDHGRTWSSPRDLTDAAIGPAYREWSTFAVGPGHCLQLH |
Carrier-free (BSA/glycerol-free) NEU2 mouse monoclonal antibody, clone OTI8C12 (formerly 8C12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
NEU2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 171-380 of human NEU2 (NP_005374.2). |
| Modifications | Unmodified |
NEU2 mouse monoclonal antibody, clone OTI8C12 (formerly 8C12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
NEU2 mouse monoclonal antibody, clone OTI8C12 (formerly 8C12), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
NEU2 mouse monoclonal antibody, clone OTI8C12 (formerly 8C12), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
NEU2 mouse monoclonal antibody, clone OTI8C12 (formerly 8C12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
