Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-NR0B2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NR0B2 |
Rabbit Polyclonal Anti-NR0B2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR0B2 antibody: synthetic peptide directed towards the N terminal of human NR0B2. Synthetic peptide located within the following region: STSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLCA |
Rabbit Polyclonal Anti-NR0B2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR0B2 antibody: synthetic peptide directed towards the middle region of human NR0B2. Synthetic peptide located within the following region: AEAPVPSILKKILLEEPSSSGGSGQLPDRPQPSLAAVQWLQCCLESFWSL |
Rabbit Polyclonal Anti-NR0B2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR0B2 antibody: synthetic peptide directed towards the middle region of human NR0B2. Synthetic peptide located within the following region: VQWLQCCLESFWSLELSPKEYACLKGTILFNPDVPGLQAASHIGHLQQEA |
Rabbit Polyclonal Anti-NR0B2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR0B2 antibody: synthetic peptide directed towards the C terminal of human NR0B2. Synthetic peptide located within the following region: LQAASHIGHLQQEAHWVLCEVLEPWCPAAQGRLTRVLLTASTLKSIPTSL |
Rabbit Polyclonal Anti-NR0B2 Antibody (Ligand-binding Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | NR0B2 / SHP antibody was raised against synthetic 16 amino acid peptide from ligand-binding domain of human NR0B2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Hamster, Rabbit (100%); Rat, Bovine, Bat (94%); Elephant, Panda, Horse, Pig, Opossum (88%); Dog (81%). |
Carrier-free (BSA/glycerol-free) NR0B2 mouse monoclonal antibody, clone OTI6D8 (formerly 6D8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NR0B2 mouse monoclonal antibody, clone OTI7B5 (formerly 7B5)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NR0B2 mouse monoclonal antibody, clone OTI2B6 (formerly 2B6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
NR0B2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NR0B2 |
NR0B2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-257 of human NR0B2 (NP_068804.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
NR0B2 mouse monoclonal antibody, clone OTI6D8 (formerly 6D8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
NR0B2 mouse monoclonal antibody, clone OTI6D8 (formerly 6D8), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
NR0B2 mouse monoclonal antibody, clone OTI6D8 (formerly 6D8), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
NR0B2 mouse monoclonal antibody, clone OTI6D8 (formerly 6D8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
NR0B2 mouse monoclonal antibody, clone OTI7B5 (formerly 7B5), Biotinylated
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Biotin |
NR0B2 mouse monoclonal antibody, clone OTI7B5 (formerly 7B5), HRP conjugated
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 420.00
4 Weeks
NR0B2 mouse monoclonal antibody, clone OTI2B6 (formerly 2B6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
NR0B2 mouse monoclonal antibody, clone OTI2B6 (formerly 2B6), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
NR0B2 mouse monoclonal antibody, clone OTI2B6 (formerly 2B6), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
NR0B2 mouse monoclonal antibody, clone OTI2B6 (formerly 2B6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- NR0B2