Germany
Japan
United Kingdom
China
Antibodies
View as table Download
NRG1 Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NRG1 |
Rabbit Polyclonal Anti-NRG1 isoform-10 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NRG1 isoform-10 Antibody: A synthesized peptide derived from human NRG1 isoform-10 |
Rabbit Polyclonal Anti-NRG1 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | NRG1 / Heregulin / Neuregulin antibody was raised against synthetic 15 amino acid peptide from N-Terminus of human NRG1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (93%); Marmoset (80%). |
Rabbit Polyclonal Anti-NRG1 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | NRG1 / Heregulin / Neuregulin antibody was raised against synthetic 17 amino acid peptide from internal region of human NRG1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset (100%); Gibbon (94%); Mouse, Rat, Hamster, Elephant, Bat, Horse, Pig, Platypus (82%). |
Rabbit Polyclonal Anti-NRG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide directed towards the N terminal of human NRG1. Synthetic peptide located within the following region: YMCKVISKLGNDSASANITIVESNEIITGMPASTEGAYVSSESPIRISVS |
Rabbit Polyclonal Anti-NRG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide directed towards the middle region of human NRG1. Synthetic peptide located within the following region: SEVQVTVQGDKAVVSFEPSAAPTPKNRIFAFSFLPSTAPSFPSPTRNPEV |
Carrier-free (BSA/glycerol-free) NRG1 mouse monoclonal antibody,clone OTI2C3
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NRG1 mouse monoclonal antibody,clone OTI3B6
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-NRG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human NRG1 |
NRG1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human NRG1 |
NRG1 mouse monoclonal antibody,clone OTI2C3
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
NRG1 mouse monoclonal antibody,clone OTI2C3
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
NRG1 mouse monoclonal antibody,clone OTI3B6
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
NRG1 mouse monoclonal antibody,clone OTI3B6
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- NRG1