Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-OTUD7B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OTUD7B antibody: synthetic peptide directed towards the middle region of human OTUD7B. Synthetic peptide located within the following region: VGTLKMGHRHQYQEEMIQRYLSDAEERFLAEQKQKEAERKIMNGGIGGGP |
Rabbit Polyclonal Anti-OTUD7B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZA20D1 antibody: synthetic peptide directed towards the middle region of human ZA20D1. Synthetic peptide located within the following region: WKGGKEEAAGDGPVSEKPPAESVGNGGSKYSQEVMQSLSILRTAMQGEGK |
Carrier-free (BSA/glycerol-free) OTUD7B mouse monoclonal antibody,clone OTI3B5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
OTUD7B Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 530-700 of human OTUD7B (NP_064590.2). |
| Modifications | Unmodified |
OTUD7B mouse monoclonal antibody,clone OTI3B5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
OTUD7B mouse monoclonal antibody,clone OTI3B5, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
OTUD7B mouse monoclonal antibody,clone OTI3B5, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
OTUD7B mouse monoclonal antibody,clone OTI3B5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- OTUD7B