Rabbit Polyclonal Anti-Pak4 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pak4 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TGFDQHEQKFTGLPRQWQSLIEESARRPKPLIDPACITSIQPGAPKTIVR |
Rabbit Polyclonal Anti-PAK4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PAK4 antibody is: synthetic peptide directed towards the middle region of Human PAK4. Synthetic peptide located within the following region: EPQLAPPACTPAAPAVPGPPGPRSPQREPQRVSHEQFRAALQLVVDPGDP |
PAK4 (incl. pos. control) mouse monoclonal antibody, clone 6C1, Purified
| Applications | WB |
| Reactivities | Canine, Human, Mouse, Rat |
PAK4 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
Rabbit anti PAK4(pS474) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding the epitope RKSLV-with a phosphorylation at Serine 474 of human PAK4. This sequence is also identical within human, rat, mouse, chicken, bovine and dog species. |
Rabbit anti PAK4 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from internal sequence of human PAK4. This sequence is also identical within human, rat, mouse, chicken, bovine and dog species. |
Carrier-free (BSA/glycerol-free) PAK4 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PAK4 mouse monoclonal antibody, clone OTI1C11 (formerly 1C11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PAK4 mouse monoclonal antibody, clone OTI3C3 (formerly 3C3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PAK4 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-280 of human PAK4 (NP_001014831.1). |
| Modifications | Unmodified |
Phospho-PAK4/5/6 (Ser474/Ser560/Ser602) Rabbit polyclonal Antibody
| Applications | FC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Phospho-PAK4 + PAK5 + PAK6 (S474 + S560 + S602) (Phosphorylated) |
PAK4 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
PAK4 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7), Biotinylated
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PAK4 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7), HRP conjugated
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PAK4 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PAK4 mouse monoclonal antibody, clone OTI1C11 (formerly 1C11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PAK4 mouse monoclonal antibody, clone OTI1C11 (formerly 1C11), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PAK4 mouse monoclonal antibody, clone OTI1C11 (formerly 1C11), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PAK4 mouse monoclonal antibody, clone OTI1C11 (formerly 1C11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PAK4 mouse monoclonal antibody, clone OTI3C3 (formerly 3C3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PAK4 mouse monoclonal antibody, clone OTI3C3 (formerly 3C3), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PAK4 mouse monoclonal antibody, clone OTI3C3 (formerly 3C3), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PAK4 mouse monoclonal antibody, clone OTI3C3 (formerly 3C3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
