Rabbit Polyclonal Anti-PLSCR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLSCR1 antibody: synthetic peptide directed towards the N terminal of human PLSCR1. Synthetic peptide located within the following region: MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP |
Rabbit Polyclonal Anti-PLSCR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLSCR1 antibody: synthetic peptide directed towards the N terminal of human PLSCR1. Synthetic peptide located within the following region: MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP |
Rabbit Polyclonal Scramblase 1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
USD 465.00
2 Weeks
Scramblase 1 (PLSCR1) (N-term) (incl. pos. control) mouse monoclonal antibody, clone 1E9, Purified
| Applications | WB |
| Reactivities | Human |
Rabbit Polyclonal Anti-PLSCR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PLSCR1 Antibody is: synthetic peptide directed towards the middle region of Human PLSCR1. Synthetic peptide located within the following region: TGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQ |
Phospholipid Scramblase 1 (PLSCR1) Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-318 of human Phospholipid Scramblase 1 (Phospholipid Scramblase 1 (PLSCR1)) (NP_066928.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
