PNPO rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PNPO |
PNPO rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PNPO |
PNPO rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PNPO |
Rabbit Polyclonal Anti-PNPO Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PNPO antibody: synthetic peptide directed towards the N terminal of human PNPO. Synthetic peptide located within the following region: PMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLAT |
PNPO mouse monoclonal antibody, clone AT2C7, Purified
Applications | ELISA, WB |
Reactivities | Human |
PNPO mouse monoclonal antibody, clone AT2C7, Purified
Applications | ELISA, WB |
Reactivities | Human |
PNPO (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 232~261 amino acids from the C-terminal region of human PNPO |
Carrier-free (BSA/glycerol-free) PNPO mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PNPO mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)
Applications | IF, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PNPO mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PNPO mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PNPO rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PNPO |
PNPO rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PNPO |
PNPO Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PNPO. |
PNPO mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PNPO mouse monoclonal antibody, clone OTI2F8 (formerly 2F8), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PNPO mouse monoclonal antibody, clone OTI2F8 (formerly 2F8), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PNPO mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PNPO mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)
Applications | IF, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
PNPO mouse monoclonal antibody, clone OTI3B3 (formerly 3B3), Biotinylated
Applications | IF, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
PNPO mouse monoclonal antibody, clone OTI3B3 (formerly 3B3), HRP conjugated
Applications | IF, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
PNPO mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)
Applications | IF, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
PNPO mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PNPO mouse monoclonal antibody, clone OTI1H9 (formerly 1H9), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PNPO mouse monoclonal antibody, clone OTI1H9 (formerly 1H9), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PNPO mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PNPO mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PNPO mouse monoclonal antibody,clone 1G9, Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PNPO mouse monoclonal antibody,clone 1G9, HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PNPO mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |