Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against PTF1A
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-WTDEKQLKEQN, from the internal region of the protein sequence according to NP_835455.1. |
Antibodies
View as table Download
Rabbit Polyclonal anti-PTF1A antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTF1A antibody: synthetic peptide directed towards the N terminal of human PTF1A. Synthetic peptide located within the following region: MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEV |
Rabbit Polyclonal Anti-PTF1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTF1A antibody: synthetic peptide directed towards the N terminal of human PTF1A. Synthetic peptide located within the following region: PLEDGDELLADEQAEVEFLSHQLHEYCYRDGACLLLQPAPPAAPLALAPP |
Rabbit Polyclonal Anti-Ptf1a Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ptf1a antibody is: synthetic peptide directed towards the N-terminal region of Mouse Ptf1a. Synthetic peptide located within the following region: FPSPYFDEEDFFTDQSSRDPLEDSDELLGDEQAEVEFLSHQLHEYCYRDG |
Carrier-free (BSA/glycerol-free) PTF1A mouse monoclonal antibody,clone OTI3G1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTF1A mouse monoclonal antibody,clone OTI5E5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PTF1A mouse monoclonal antibody,clone OTI3G1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PTF1A mouse monoclonal antibody,clone OTI3G1, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PTF1A mouse monoclonal antibody,clone OTI3G1, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PTF1A mouse monoclonal antibody,clone OTI3G1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PTF1A mouse monoclonal antibody,clone OTI5E5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
2 Weeks
PTF1A mouse monoclonal antibody,clone OTI5E5, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PTF1A mouse monoclonal antibody,clone OTI5E5, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PTF1A mouse monoclonal antibody,clone OTI5E5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Active filters
Target Symbol
- PTF1A