Rabbit Polyclonal Anti-GNB2L1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNB2L1 antibody: synthetic peptide directed towards the N terminal of human GNB2L1. Synthetic peptide located within the following region: ISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQI |
Rabbit Polyclonal Anti-GNB2L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNB2L1 antibody: synthetic peptide directed towards the C terminal of human GNB2L1. Synthetic peptide located within the following region: LEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVW |
Rabbit anti-GNB2L1 Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GNB2L1 |
Rabbit Polyclonal Antibody against GNB2L1 (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GNB2L1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 29-58 amino acids from the N-terminal region of human GNB2L1. |
Goat Polyclonal Anti-LYVE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LYVE1 Antibody: Peptide with sequence C-STETEPFVENK, from the internal region of the protein sequence according to NP_006682.2. |
Rabbit Polyclonal Anti-GNB2L1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Gnb2l1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Gnb2l1. Synthetic peptide located within the following region: HIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIIN |
RACK1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
RACK1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RACK1 |
RACK1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-290 of human RACK1 (NP_006089.1). |
| Modifications | Unmodified |
RACK1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-290 of human RACK1 (NP_006089.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
