Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Anti-RBBP4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBBP4 antibody: synthetic peptide directed towards the N terminal of human RBBP4. Synthetic peptide located within the following region: HTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK |
Rabbit polyclonal Anti-Rbbp4 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Rbbp4 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rbbp4. Synthetic peptide located within the following region: TAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQ |
Mouse Monoclonal RbAp 46/48 Antibody
| Applications | WB |
| Reactivities | Human |
Mouse Monoclonal RbAp 46/48 Antibody
| Applications | WB |
| Reactivities | Human |
RBBP4 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RBBP4 |
RBBP4 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RBBP4 |
RBBP4 Rabbit polyclonal Antibody
| Applications | ChIP, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-425 of human RBBP4 (NP_005601.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- RBBP4