Germany
Japan
United Kingdom
China
Antibodies
View as table Download
SLC22A17 Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rat |
| Conjugation | Unconjugated |
| Immunogen | SLC22A17 antibody was raised against synthetic peptide C-PETKRKLLPEVLRD from an internal region of human SLC22A17 (NP_065105.2; NP_057693.3). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Dog, Bat, Bovine, Horse, Pig (100%); Elephant, Rabbit (93%). |
Rabbit Polyclonal Anti-SLC22A17 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC22A17 Antibody: synthetic peptide directed towards the middle region of human SLC22A17. Synthetic peptide located within the following region: HCYQPVGGGGSPSDFYLCSLLASGTAALACVFLGVTVDRFGRRGILLLSM |
Anti-SLC22A17 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 511-524 amino acids of human solute carrier family 22, member 17 |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
SLC22A17 mouse monoclonal antibody,clone OTI2D6
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- SLC22A17