Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-TANK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TANK antibody is: synthetic peptide directed towards the N-terminal region of Human TANK. Synthetic peptide located within the following region: ILYSDATGRRGMDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQ |
Rabbit Polyclonal Anti-TANK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TANK antibody: synthetic peptide directed towards the C terminal of human TANK. Synthetic peptide located within the following region: KPFPNQDSDSVVLSGTDSELHIPRVCEFCQAVFPPSITSRGDFLRHLNSH |
Rabbit Polyclonal Anti-TANK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TANK antibody: synthetic peptide directed towards the N terminal of human TANK. Synthetic peptide located within the following region: DKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQ |
Tank Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
TANK Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 24-100 of human TANK (NP_597841.1). |
| Modifications | Unmodified |
TANK Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-119 of human TANK (NP_597841.1). |
| Modifications | Unmodified |
TANK mouse monoclonal antibody,clone OTI1G2
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
Active filters
Target Symbol
- TANK