Antibodies

View as table Download

Goat Anti-TFB1M Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-ELKRRKSKNEEKE, from the C-Terminus of the protein sequence according to NP_057104.2.

Rabbit Polyclonal Anti-TFB1M Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TFB1M Antibody: synthetic peptide directed towards the N terminal of human TFB1M. Synthetic peptide located within the following region: NFLLDLRLTDKIVRKAGNLTNAYVYEVGPGPGGITRSILNADVAELLVVE

Rabbit Polyclonal Anti-TFB1M Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TFB1M Antibody: synthetic peptide directed towards the middle region of human TFB1M. Synthetic peptide located within the following region: IIKWLENISCRDGPFVYGRTQMTLTFQKEVAERLAANTGSKQRSRLSVMA

Carrier-free (BSA/glycerol-free) TFB1M mouse monoclonal antibody, clone OTI6G4 (formerly 6G4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TFB1M mouse monoclonal antibody, clone OTI11H1 (formerly 11H1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) TFB1M mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TFB1M mouse monoclonal antibody, clone OTI13H2 (formerly 13H2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TFB1M mouse monoclonal antibody, clone OTI10H8 (formerly 10H8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TFB1M Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 28-346 of human TFB1M (NP_057104.2).
Modifications Unmodified

TFB1M mouse monoclonal antibody, clone OTI6G4 (formerly 6G4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TFB1M mouse monoclonal antibody, clone OTI6G4 (formerly 6G4), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

TFB1M mouse monoclonal antibody, clone OTI6G4 (formerly 6G4), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

TFB1M mouse monoclonal antibody, clone OTI6G4 (formerly 6G4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TFB1M mouse monoclonal antibody, clone OTI11H1 (formerly 11H1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TFB1M mouse monoclonal antibody, clone OTI11H1 (formerly 11H1), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

TFB1M mouse monoclonal antibody, clone OTI11H1 (formerly 11H1), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

TFB1M mouse monoclonal antibody, clone OTI11H1 (formerly 11H1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TFB1M mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TFB1M mouse monoclonal antibody, clone OTI3G8 (formerly 3G8), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

TFB1M mouse monoclonal antibody, clone OTI3G8 (formerly 3G8), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

TFB1M mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TFB1M mouse monoclonal antibody, clone OTI13H2 (formerly 13H2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TFB1M mouse monoclonal antibody, clone OTI13H2 (formerly 13H2), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

TFB1M mouse monoclonal antibody, clone OTI13H2 (formerly 13H2), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

TFB1M mouse monoclonal antibody, clone OTI13H2 (formerly 13H2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Purified TFB1M mouse monoclonal antibody, clone OTI10H8 (formerly 10H8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Purified TFB1M mouse monoclonal antibody, clone OTI10H8 (formerly 10H8), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Purified TFB1M mouse monoclonal antibody, clone OTI10H8 (formerly 10H8), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Purified TFB1M mouse monoclonal antibody, clone OTI10H8 (formerly 10H8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated