Rabbit Polyclonal Anti-TMED10 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMED10 antibody: synthetic peptide directed towards the middle region of human TMED10. Synthetic peptide located within the following region: KLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIF |
Rabbit Polyclonal Tmp21/p23 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Primate, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal sequence of the human TMP21 protein (within residues 100-200). [Swiss-Prot# P49755] |
Rabbit Polyclonal Tmp21/p23 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, Primate, Rabbit, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal sequence of the human TMP21 protein (within residues 50-150). [Swiss-Prot# P49755] |
TMED10 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human TMED10 |
TMED10 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TMED10 |
TMED10 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 35-190 of human TMED10 (NP_006818.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
