Rabbit polyclonal TOB1 (Ser164) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human TOB1 around the phosphorylation site of serine 164 (A-V-SP-P-T). |
| Modifications | Phospho-specific |
Rabbit polyclonal TOB1 (Ab-164) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TOB1 around the phosphorylation site of serine 164 (A-V-SP-P-T). |
Rabbit Polyclonal Anti-TOB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TOB1 antibody: synthetic peptide directed towards the middle region of human TOB1. Synthetic peptide located within the following region: DLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKT |
Rabbit Polyclonal Anti-TOB1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TOB1 antibody: synthetic peptide directed towards the middle region of mouse TOB1. Synthetic peptide located within the following region: QPLTFTTATFAATKFGSTKMKNSGRSSKVARTSPINLGLTVNVNDLLKQK |
TOB1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human TOB1 |
TOB1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human TOB1 (NP_005740.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
