Antibodies

View as table Download

Rabbit anti-TRADD Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TRADD

TRADD (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 133-159 amino acids from the Central region of human TRADD

Rabbit polyclonal anti-TRADD antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human TRADD.

Rabbit Polyclonal Anti-TRADD Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TRADD Antibody: A synthesized peptide derived from human TRADD

Rabbit Polyclonal antibody to TRADD (TNFRSF1A-associated via death domain)

Applications IF, IHC, WB
Reactivities Human
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 43 of TRADD (Uniprot ID#Q15628)

Rabbit Polyclonal Anti-TRADD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRADD antibody: synthetic peptide directed towards the middle region of human TRADD. Synthetic peptide located within the following region: YEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGL

TRADD Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TRADD

TRADD Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TRADD

TRADD rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TRADD

TRADD rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TRADD

TRADD Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TRADD.