Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-UBD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | UBD antibody was raised against a 16 amino acid peptide near the center of human UBD. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SLCO1B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | SLCO1B1 antibody was raised against a 14 amino acid peptide near the carboxy terminus of human SLCO1B1. |
Rabbit polyclonal anti-UBD antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human UBD |
Rabbit Polyclonal Anti-UBD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBD antibody: synthetic peptide directed towards the N terminal of human UBD. Synthetic peptide located within the following region: RSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEE |
UBD rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human UBD |
FAT10/UBD Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human FAT10/FAT10/UBD (NP_006389.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- UBD