Antibodies

View as table Download

Rabbit Polyclonal antibody to UNC13D (unc-13 homolog D (C. elegans))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1029 and 1090 of Munc 13-4 (Uniprot ID#Q70J99)

Goat Anti-Munc13-4 / UNC13D (C terminus) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KQASQHALRPAP, from the C Terminus of the protein sequence according to NP_954712.1.

Rabbit Polyclonal Anti-UNC13D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UNC13D antibody is: synthetic peptide directed towards the C-terminal region of Human UNC13D. Synthetic peptide located within the following region: SGSEEPGEVPQTRLPLTYPAPNGDPILQLLEGRKGDREAQVFVRLRRHRA

Carrier-free (glycerol/BSA-free) UNC13D mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

UNC13D Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 891-1090 of human UNC13D (NP_954712.1).
Modifications Unmodified

UNC13D mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

UNC13D mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated