Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal PD-L1 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
CD274 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CD274 |
Rabbit Polyclonal PDL-2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PDL-2 antibody was raised against a 16 amino acid peptide from near the center of human PDL-2. |
PD L2 (PDCD1LG2) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 45-75 amino acids from the N-terminal region of Human CD273 / PDL2 |
Rabbit Polyclonal Anti-HLA-A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HLA-A antibody is: synthetic peptide directed towards the N-terminal region of Human HLA-A. Synthetic peptide located within the following region: SDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQ |