Antibody Sample

View as table Download

Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal PD-L1 Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1.

CD274 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CD274

Rabbit Polyclonal PDL-2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PDL-2 antibody was raised against a 16 amino acid peptide from near the center of human PDL-2.

PD L2 (PDCD1LG2) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 45-75 amino acids from the N-terminal region of Human CD273 / PDL2

Rabbit Polyclonal Anti-HLA-A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-A antibody is: synthetic peptide directed towards the N-terminal region of Human HLA-A. Synthetic peptide located within the following region: SDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQ

Rabbit Polyclonal Anti-PDCD1LG2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human PDCD1LG2