Germany
Japan
United Kingdom
China
Antibody Sample
View as table Download
HLA-A/B/C rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HLA-A/B/C |
CD274 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CD274 |
CD274 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CD274 |
USD 465.00
2 Weeks
ErbB 3 (ERBB3) (Cytopl. Dom.) (incl. pos. control) mouse monoclonal antibody, clone 5A12, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
FLIP (CFLAR) (1-376) mouse monoclonal antibody, clone AT8B12, Purified
| Applications | ELISA, IF, WB |
| Reactivities | Human, Mouse, Rat |
FLIP (CFLAR) (1-376) mouse monoclonal antibody, clone AT8B12, Purified
| Applications | ELISA, IF, WB |
| Reactivities | Human, Mouse, Rat |
ErbB 3 (ERBB3) pTyr1328 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Her3/ErbB3 around the phosphorylation site of Tyrosine 1328 (P-D-YP-W-H). |
ErbB 3 (ERBB3) pTyr1328 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Her3/ErbB3 around the phosphorylation site of Tyrosine 1328 (P-D-YP-W-H). |
Prealbumin (TTR) (Center) rabbit polyclonal antibody, Purified
| Applications | FC, IHC, WB |
| Reactivities | Bovine, Human |
| Immunogen | KLH conjugated synthetic peptide between 47-74 amino acids from the Central region of human TTR. |
Apolipoprotein A I (APOA1) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_000030.1. |
Goat Polyclonal Antibody against TPTE
| Applications | WB |
| Reactivities | Test: Human. Expected from seq similarity: Human |
| Immunogen | Peptide with sequence C-ERRTDKTHSEKFQ, from the internal region of the protein sequence according to NP_954870.2; NP_954868.1; NP_954869.1. |
Rabbit Polyclonal FLIP Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | FLIP antibody was raised against a peptide corresponding to 17 amino acids near the amino terminus of human FLIP. The sequence is identical in all FLIP splice variants. The immunogen is located within the first 50 amino acids of FLIP. |
Rabbit polyclonal CASP8 (Cleaved-Asp384) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CASP8. |
Rabbit Polyclonal Caspase 8 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 8 |
Rabbit Polyclonal PPAR-BP Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PPAR-BP |
Rabbit Polyclonal PPAR-BP (Thr1457) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PPAR-BP around the phosphorylation site of Threonine 1457 |
| Modifications | Phospho-specific |
Rabbit polyclonal ANXA2 (Phospho-Ser26) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ANXA2 around the phosphorylation site of serine 26. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PTEN (Ser370) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PTEN around the phosphorylation site of Serine 370 |
| Modifications | Phospho-specific |
Rabbit Polyclonal PTEN Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PTEN |
Rabbit Polyclonal Anti-ANXA2R Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANXA2R antibody: synthetic peptide directed towards the N terminal of human ANXA2R. Synthetic peptide located within the following region: EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS |
USD 435.00
2 Weeks
PINK1 mouse monoclonal antibody, clone 38CT20.8.5, Purified
| Applications | WB |
| Reactivities | Human |
USD 340.00
2 Weeks
Apolipoprotein A I (APOA1) (25-267) mouse monoclonal antibody, clone AT1E12, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
USD 230.00
2 Weeks
Apolipoprotein A I (APOA1) (25-267) mouse monoclonal antibody, clone AT1E12, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
ASF1B mouse monoclonal antibody, clone AT1D4, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Active filters
Applications
- WB
Filter by
Category
Target Symbol
- CD274 (117)
- PDCD1LG2 (70)
- KRAS (60)
- ERBB3 (49)
- SERPINA1 (42)
- CFLAR (36)
- ASF1B (26)
- PTEN (24)
- HLA-A (22)
- GC (19)
- TGFBR2 (18)
- CASP8 (16)
- ANXA2 (11)
- TTR (10)
- APOA1 (9)
- TPTE (9)
- DEDD (7)
- ARID1A (6)
- CASP8AP2 (4)
- MED1 (4)
- ANXA2R (3)
- MBD4 (3)
- SHKBP1 (3)
- C2ORF76 (2)
- NAXE (2)
- NRAS (2)
- ALKBH6 (1)
- HLA-A/B/C (1)
- PD-L1 (1)
Reactivities
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
Pathways
- Cell adhesion molecules (CAMs) (195)
- ErbB signaling pathway (107)
- Pathways in cancer (100)
- Endocytosis (79)
- Natural killer cell mediated cytotoxicity (75)
- Chronic myeloid leukemia (74)
- MAPK signaling pathway (74)
- Endometrial cancer (73)
- Glioma (73)
- Melanoma (73)
- Prostate cancer (73)
- Tight junction (73)
- Colorectal cancer (72)
- Pancreatic cancer (72)
- Acute myeloid leukemia (59)
- Axon guidance (59)
- B cell receptor signaling pathway (59)
- Bladder cancer (59)
- Chemokine signaling pathway (59)
- Fc epsilon RI signaling pathway (59)
- Gap junction (59)
- GnRH signaling pathway (59)
- Insulin signaling pathway (59)
- Long-term depression (59)
- Long-term potentiation (59)
- Melanogenesis (59)
- Neurotrophin signaling pathway (59)
- Non-small cell lung cancer (59)
- Regulation of actin cytoskeleton (59)
- Renal cell carcinoma (59)
- T cell receptor signaling pathway (59)
- Thyroid cancer (59)
- VEGF signaling pathway (59)
- Dorso-ventral axis formation (57)
- Progesterone-mediated oocyte maturation (57)
- Calcium signaling pathway (48)
- Apoptosis (47)
- Complement and coagulation cascades (41)
- Viral myocarditis (28)
- p53 signaling pathway (26)
- Allograft rejection (16)
- Antigen processing and presentation (16)
- Autoimmune thyroid disease (16)
- Graft-versus-host disease (16)
- Type I diabetes mellitus (16)
- Adherens junction (15)
- Cytokine-cytokine receptor interaction (15)
- TGF-beta signaling pathway (15)
- Focal adhesion (14)
- Inositol phosphate metabolism (14)
- Phosphatidylinositol signaling system (14)
- Small cell lung cancer (14)
- Alzheimer's disease (12)
- Huntington's disease (12)
- NOD-like receptor signaling pathway (12)
- RIG-I-like receptor signaling pathway (12)
- Toll-like receptor signaling pathway (12)
- PPAR signaling pathway (5)
- Base excision repair (1)