Mouse Monoclonal Anti-PD-L2 Antibody [7C1]
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-PD-L2 Antibody [7C1]
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-PD-L2 Antibody [10H6]
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-PD-L1 Antibody [4F2]
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-PD-L1 Antibody [8E12]
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
HLA-A/B/C rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HLA-A/B/C |
CD274 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CD274 |
CD274 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CD274 |
Rabbit Polyclonal ErbB3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. In vivo generated recombinant protein fragment |
PINK1 mouse monoclonal antibody, clone N4/15
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PINK1 mouse monoclonal antibody, clone N4/49
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
2 Weeks
ErbB 3 (ERBB3) (Cytopl. Dom.) (incl. pos. control) mouse monoclonal antibody, clone 5A12, Purified
Applications | IF, IHC, WB |
Reactivities | Human |
PTEN mouse monoclonal antibody, clone 1B8, Aff - Purified
Applications | ELISA, IF, WB |
Reactivities | Human, Mouse |
FLIP (CFLAR) (1-376) mouse monoclonal antibody, clone AT8B12, Purified
Applications | ELISA, IF, WB |
Reactivities | Human, Mouse, Rat |
FLIP (CFLAR) (1-376) mouse monoclonal antibody, clone AT8B12, Purified
Applications | ELISA, IF, WB |
Reactivities | Human, Mouse, Rat |
PTEN pSer380/pThr382/383 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic phosphopeptide derived from human PTEN around the phosphorylation site of serine 380 and threonine 382/383 (R-Y-SP-D-TP-TP-D-S). |
PTEN rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | This antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of serine 370 (D-V-SP-D-N). |
ErbB 3 (ERBB3) pTyr1328 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Her3/ErbB3 around the phosphorylation site of Tyrosine 1328 (P-D-YP-W-H). |
ErbB 3 (ERBB3) pTyr1328 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Her3/ErbB3 around the phosphorylation site of Tyrosine 1328 (P-D-YP-W-H). |
ErbB 3 (ERBB3) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide sequence around amino acids 1326~1330 (P-D-Y-W-H) derived from Human Her3/ErbB3. |
ErbB 3 (ERBB3) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide sequence around amino acids 1326~1330 (P-D-Y-W-H) derived from Human Her3/ErbB3. |
PINK1 rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide in the N-terminal region of human Park6 (PINK1). |
ErbB 3 (ERBB3) (N-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human ErbB3. |
Prealbumin (TTR) (Center) rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Bovine, Human |
Immunogen | KLH conjugated synthetic peptide between 47-74 amino acids from the Central region of human TTR. |
Apolipoprotein A I (APOA1) goat polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_000030.1. |
ALKBH6 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 123-153 amino acids from the Central region of human ALKBH |
FLIP (CFLAR) (Center) rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 152~182 amino acids from the Center region of human CFLAR |
Goat Polyclonal Antibody against TPTE
Applications | WB |
Reactivities | Test: Human. Expected from seq similarity: Human |
Immunogen | Peptide with sequence C-ERRTDKTHSEKFQ, from the internal region of the protein sequence according to NP_954870.2; NP_954868.1; NP_954869.1. |
Rabbit Polyclonal FLIP Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | FLIP antibody was raised against a peptide corresponding to 17 amino acids near the amino terminus of human FLIP. The sequence is identical in all FLIP splice variants. The immunogen is located within the first 50 amino acids of FLIP. |
Chicken Polyclonal Transthyretin Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Transthyretin antibody was raised against a 17 amino acid peptide near the center of human Transthyretin . |
Rabbit polyclonal antibody to DEDD (death effector domain containing)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 129 and 223 of DEDD (Uniprot ID#O75618) |
Rabbit polyclonal CASP8 (Cleaved-Asp384) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human CASP8. |
Rabbit Polyclonal Caspase 8 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 8 |
Rabbit Polyclonal PPAR-BP Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PPAR-BP |
Rabbit Polyclonal PPAR-BP (Thr1457) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PPAR-BP around the phosphorylation site of Threonine 1457 |
Modifications | Phospho-specific |
Rabbit polyclonal ANXA2 (Phospho-Ser26) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ANXA2 around the phosphorylation site of serine 26. |
Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PTEN (Ser370) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PTEN around the phosphorylation site of Serine 370 |
Modifications | Phospho-specific |
Rabbit Polyclonal PTEN Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PTEN |
Rabbit Polyclonal Anti-ANXA2R Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANXA2R antibody: synthetic peptide directed towards the N terminal of human ANXA2R. Synthetic peptide located within the following region: EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS |
Mouse Monoclonal Caspase-8 Antibody (90A992)
Applications | FC, IHC, WB |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-PD-L1 Antibody [6H10]
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-PD-L1 Antibody [2D6]
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-PD-L1 Antibody [1F11]
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-PD-L1 Antibody [1D7]
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 435.00
2 Weeks
Apolipoprotein A I (APOA1) mouse monoclonal antibody, clone 5F4F5, Ascites
Applications | ELISA, WB |
Reactivities | Human |
ErbB 3 (ERBB3) mouse monoclonal antibody, clone 3F10F6, Ascites
Applications | IHC, WB |
Reactivities | Human |
ErbB 3 (ERBB3) mouse monoclonal antibody, clone 2F9, Ascites
Applications | IF, WB |
Reactivities | Human |
PINK1 mouse monoclonal antibody, clone 38CT20.8.5, Purified
Applications | WB |
Reactivities | Human |
USD 340.00
2 Weeks
Apolipoprotein A I (APOA1) (25-267) mouse monoclonal antibody, clone AT1E12, Purified
Applications | ELISA, WB |
Reactivities | Human |
USD 230.00
2 Weeks
Apolipoprotein A I (APOA1) (25-267) mouse monoclonal antibody, clone AT1E12, Purified
Applications | ELISA, WB |
Reactivities | Human |
ASF1B mouse monoclonal antibody, clone AT1D4, Purified
Applications | ELISA, WB |
Reactivities | Human |