Germany
Japan
United Kingdom
China
Antibody Sample
Rabbit anti-ANXA2 (Annexin A2) polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | a 16 amino acid peptide from near the N terminal residues of human Annexin A2 protein |
USD 379.00
In Stock
Goat Polyclonal Antibody against Vitamin D-binding protein / GC
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDNLSTKNSKFED, from the internal region of the protein sequence according to NP_000574.2. |
Rabbit polyclonal anti-HER3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-HER3 whole rabbit serum was prepared by repeated immunizations with a HER3 fusion protein corresponding to amino acids 1283 to 1323 (40 amino acids) at the carboxy-terminus of human HER3. |
Chicken Polyclonal ApoA1 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ApoA1 antibody was raised against a 17 amino acid synthetic peptide from near the amino terminus of human ApoA1. The immunogen is located within the first 50 amino acids of ApoA1. |
Rabbit polyclonal TTR Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TTR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 71-98 amino acids from the C-terminal region of human TTR. |
Prealbumin (TTR) (Center) rabbit polyclonal antibody, Purified
| Applications | FC, IHC, WB |
| Reactivities | Bovine, Human |
| Immunogen | KLH conjugated synthetic peptide between 47-74 amino acids from the Central region of human TTR. |
Rabbit polyclonal ANXA2 (Phospho-Ser26) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ANXA2 around the phosphorylation site of serine 26. |
| Modifications | Phospho-specific |
USD 340.00
2 Weeks
Apolipoprotein A I (APOA1) (25-267) mouse monoclonal antibody, clone AT1E12, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
USD 230.00
2 Weeks
Apolipoprotein A I (APOA1) (25-267) mouse monoclonal antibody, clone AT1E12, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Prealbumin (TTR) goat polyclonal antibody, Serum
| Applications | ID, IP |
| Reactivities | Human |
| Immunogen | Transthyretin is the fastest protein in the immunoelectrophoresis pattern of human serum. It consists of four identical polypeptide chains with no carbohydrate The molecular weight is 55,000 and the concentration in normal serum ranges from 0.1 to 0.4 mg/ml. It can bind thyroxine and retinal and its concentration is reduced in severe liver diseases. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal ApoA1 Antibody
| Applications | WB |
| Reactivities | Chicken, Human |
| Conjugation | Unconjugated |
| Immunogen | ApoA1 antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human ApoA1. |
Rabbit anti-SERPINA1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SERPINA1 |
USD 530.00
2 Weeks
ErbB 3 (ERBB3) (C-term) (incl. pos. control) mouse monoclonal antibody, clone 11A4, Biotin
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ErbB 3 (ERBB3) rabbit polyclonal antibody, Aff - Purified
| Applications | IF |
| Reactivities | Human |
| Immunogen | Synhesized non-phosphopeptide derived from human Her3/ErbB3 around the phosphorylation site of Tyr1289 (Q-G-YPE-E) |
ErbB 3 (ERBB3) rabbit polyclonal antibody, Aff - Purified
| Applications | IF |
| Reactivities | Human |
| Immunogen | Synhesized non-phosphopeptide derived from human Her3/ErbB3 around the phosphorylation site of Tyr1289 (Q-G-YPE-E) |
Apolipoprotein A I (APOA1) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of human APOA1 |
Goat Polyclonal Antibody against Calretinin
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence STVHEILCKLSLEGD, from the N Terminus of the protein sequence according to NP_001002858.1; NP_004030.1; NP_001002857.1. |
Rabbit polyclonal Alpha-1-Trypsin antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Human Alpha-1-anti-Trypsin |
Goat Anti-prealbumin / transthyretin (aa62-74) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EPFASGKTSESGE, from the internal region of the protein sequence according to NP_000362.1. |
Goat Anti-alpha-1-antitrypsin Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QKTDTSHHDQDHP, from the internal region (near N terminus) of the protein sequence according to NP_000286.3. |
Goat Anti-alpha-1-antitrypsin (aa230-241) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EDFHVDQVTTVK, from the internal region of the protein sequence according to NP_000286.3. |
Rabbit Polyclonal Anti-ANXA2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANXA2 antibody: synthetic peptide directed towards the C terminal of human ANXA2. Synthetic peptide located within the following region: RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD |
Rabbit Polyclonal Anti-GC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GC antibody: synthetic peptide directed towards the N terminal of human GC. Synthetic peptide located within the following region: KHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLV |
Rabbit anti c-erbB3 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse anti c-erbB-3/HER-3 Monoclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti C-erbB3/HER3 (pY1283) Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti C-erbB3/HER3 (Paired Y1283) Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti C-erbB3/HER3 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 465.00
4 Weeks
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
In Stock
Active filters
Category
-
- Antibodies
-
Families
- Secreted Protein