ErbB 3 (ERBB3) mouse monoclonal antibody, clone DY-7G2, Purified
Applications | ELISA, FC, WB |
Reactivities | Human |
ErbB 3 (ERBB3) mouse monoclonal antibody, clone DY-7G2, Purified
Applications | ELISA, FC, WB |
Reactivities | Human |
Rabbit Monoclonal Antibody against TTR (Clone EP2929Y)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal antibody against Prealbumin(clone EPR2928(2))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-HER3 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HER3. |
Rabbit anti-ANXA2 (Annexin A2) polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | a 16 amino acid peptide from near the N terminal residues of human Annexin A2 protein |
USD 379.00
In Stock
SERPINA1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI11G2
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700007 |
Goat Polyclonal Antibody against Vitamin D-binding protein / GC
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CDNLSTKNSKFED, from the internal region of the protein sequence according to NP_000574.2. |
Rabbit monoclonal antibody against HER3/ErbB3 Phospho (pY1289) (EPR2325 ) (phospho-specific)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Modifications | Phospho-specific |
Rabbit polyclonal anti-HER3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Anti-HER3 whole rabbit serum was prepared by repeated immunizations with a HER3 fusion protein corresponding to amino acids 1283 to 1323 (40 amino acids) at the carboxy-terminus of human HER3. |
ErbB 3 (ERBB3) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 1250-1300 of Human ErbB-3. |
Chicken Polyclonal ApoA1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ApoA1 antibody was raised against a 17 amino acid synthetic peptide from near the amino terminus of human ApoA1. The immunogen is located within the first 50 amino acids of ApoA1. |
TTR / Transthyretin Goat Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TTR / Transthyretin antibody was raised against purified human Prealbumin. |
Rabbit polyclonal TTR Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TTR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 71-98 amino acids from the C-terminal region of human TTR. |
Rabbit Polyclonal ErbB3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. In vivo generated recombinant protein fragment |
Prealbumin (TTR) (Center) rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Bovine, Human |
Immunogen | KLH conjugated synthetic peptide between 47-74 amino acids from the Central region of human TTR. |
Chicken Polyclonal Transthyretin Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Transthyretin antibody was raised against a 17 amino acid peptide near the center of human Transthyretin . |
Rabbit polyclonal ANXA2 (Phospho-Ser26) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ANXA2 around the phosphorylation site of serine 26. |
Modifications | Phospho-specific |
USD 340.00
2 Weeks
Apolipoprotein A I (APOA1) (25-267) mouse monoclonal antibody, clone AT1E12, Purified
Applications | ELISA, WB |
Reactivities | Human |
USD 230.00
2 Weeks
Apolipoprotein A I (APOA1) (25-267) mouse monoclonal antibody, clone AT1E12, Purified
Applications | ELISA, WB |
Reactivities | Human |
Annexin A2 (ANXA2) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 111-160 of Human Annexin 2. |
Prealbumin (TTR) goat polyclonal antibody, Serum
Applications | ID, IP |
Reactivities | Human |
Immunogen | Transthyretin is the fastest protein in the immunoelectrophoresis pattern of human serum. It consists of four identical polypeptide chains with no carbohydrate The molecular weight is 55,000 and the concentration in normal serum ranges from 0.1 to 0.4 mg/ml. It can bind thyroxine and retinal and its concentration is reduced in severe liver diseases. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Goat Polyclonal Antibody against ERBB3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HSRLFPKANAQRT, from the C Terminus of the protein sequence according to NP_001973.2. |
Rabbit Polyclonal ApoA1 Antibody
Applications | WB |
Reactivities | Chicken, Human |
Conjugation | Unconjugated |
Immunogen | ApoA1 antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human ApoA1. |
Rabbit anti-SERPINA1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SERPINA1 |
USD 530.00
2 Weeks
ErbB 3 (ERBB3) (C-term) (incl. pos. control) mouse monoclonal antibody, clone 11A4, Biotin
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
ErbB 3 (ERBB3) rabbit polyclonal antibody, Aff - Purified
Applications | IF |
Reactivities | Human |
Immunogen | Synhesized non-phosphopeptide derived from human Her3/ErbB3 around the phosphorylation site of Tyr1289 (Q-G-YPE-E) |
ErbB 3 (ERBB3) rabbit polyclonal antibody, Aff - Purified
Applications | IF |
Reactivities | Human |
Immunogen | Synhesized non-phosphopeptide derived from human Her3/ErbB3 around the phosphorylation site of Tyr1289 (Q-G-YPE-E) |
Apolipoprotein A I (APOA1) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of human APOA1 |
Goat Polyclonal Antibody against Calretinin
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence STVHEILCKLSLEGD, from the N Terminus of the protein sequence according to NP_001002858.1; NP_004030.1; NP_001002857.1. |
Rabbit polyclonal Alpha-1-Trypsin antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Human Alpha-1-anti-Trypsin |
Goat polyclonal Alpha-1-Anti-Trypsin antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | a1-Anti-Trypsin [Human Plasma] |
Goat polyclonal Alpha 1 Anti Trypsin antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | a1-Anti-Trypsin [Human Plasma] |
Goat Anti-prealbumin / transthyretin (aa62-74) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EPFASGKTSESGE, from the internal region of the protein sequence according to NP_000362.1. |
Goat Anti-alpha-1-antitrypsin Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QKTDTSHHDQDHP, from the internal region (near N terminus) of the protein sequence according to NP_000286.3. |
Goat Anti-alpha-1-antitrypsin (aa230-241) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EDFHVDQVTTVK, from the internal region of the protein sequence according to NP_000286.3. |
Rabbit Polyclonal Anti-ANXA2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANXA2 antibody: synthetic peptide directed towards the C terminal of human ANXA2. Synthetic peptide located within the following region: RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD |
Rabbit Polyclonal Anti-GC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GC antibody: synthetic peptide directed towards the N terminal of human GC. Synthetic peptide located within the following region: KHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLV |
Rabbit anti c-erbB3 Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Mouse anti c-erbB-3/HER-3 Monoclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti C-erbB3/HER3 (pY1283) Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti C-erbB3/HER3 (Paired Y1283) Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti C-erbB3/HER3 Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) SERPINA1 mouse monoclonal antibody, clone OTI3C5 (formerly 3C5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) SERPINA1 mouse monoclonal antibody, clone OTI5B12 (formerly 5B12)
Applications | IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) SERPINA1 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)
Applications | FC, IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) SERPINA1 mouse monoclonal antibody, clone OTI15H10 (formerly 15H10)
Applications | IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) SERPINA1 mouse monoclonal antibody, clone OTI8E3 (formerly 8E3)
Applications | IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) SERPINA1 mouse monoclonal antibody, clone OTI11G2 (formerly 11G2)
Applications | IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) ERBB3 mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)
Applications | FC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |