Germany
Japan
United Kingdom
China
Rabbit anti-ANXA2 (Annexin A2) polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | a 16 amino acid peptide from near the N terminal residues of human Annexin A2 protein |
Antibody Sample
View as table Download
Chicken Polyclonal ApoA1 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ApoA1 antibody was raised against a 17 amino acid synthetic peptide from near the amino terminus of human ApoA1. The immunogen is located within the first 50 amino acids of ApoA1. |
Rabbit polyclonal ANXA2 (Phospho-Ser26) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ANXA2 around the phosphorylation site of serine 26. |
| Modifications | Phospho-specific |
Rabbit anti-SERPINA1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SERPINA1 |
Goat Polyclonal Antibody against Calretinin
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence STVHEILCKLSLEGD, from the N Terminus of the protein sequence according to NP_001002858.1; NP_004030.1; NP_001002857.1. |
Rabbit Polyclonal Anti-ANXA2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANXA2 antibody: synthetic peptide directed towards the C terminal of human ANXA2. Synthetic peptide located within the following region: RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD |
Anti-APOA1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 14-267 amino acids of human apolipoprotein A-I |
Anti-SERPINA1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 25-307 amino acids of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 |
Anti-SERPINA1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 25-307 amino acids of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 |
Anti-TTR Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-GC Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 217-474 amino acids of human group-specific component (vitamin D binding protein) |
Anti-ANXA2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-ERBB3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) |
Active filters
Reactivities
- Mouse
Clonalities
- Polyclonal
Families
- Secreted Protein