Germany
Japan
United Kingdom
China
Antibody Sample
View as table Download
Rabbit Polyclonal FLIP Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | FLIP antibody was raised against a peptide corresponding to 17 amino acids near the amino terminus of human FLIP. The sequence is identical in all FLIP splice variants. The immunogen is located within the first 50 amino acids of FLIP. |
Rabbit polyclonal CASP8 (Cleaved-Asp384) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CASP8. |
Rabbit polyclonal TGF beta Receptor II (Ser225/250) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human TGF β Receptor II around the phosphorylation site of serine 225/250 (D-R-SP-D-I). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Caspase 8 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 8 |
Rabbit Polyclonal PPAR-BP Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PPAR-BP |
Rabbit Polyclonal PPAR-BP (Thr1457) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PPAR-BP around the phosphorylation site of Threonine 1457 |
| Modifications | Phospho-specific |
Rabbit polyclonal ANXA2 (Phospho-Ser26) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ANXA2 around the phosphorylation site of serine 26. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PTEN (Ser370) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PTEN around the phosphorylation site of Serine 370 |
| Modifications | Phospho-specific |
Rabbit Polyclonal PTEN Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PTEN |
Rabbit Polyclonal Anti-ANXA2R Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANXA2R antibody: synthetic peptide directed towards the N terminal of human ANXA2R. Synthetic peptide located within the following region: EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS |
Rabbit Polyclonal Caspase 8 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
PINK1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit anti-PTEN (Phospho-Ser380/Thr382/Thr383) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse and Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanPTEN around the phosphorylation site of serine 380 and threonine 382/383(R-Y-SP-D-TP-TP-D-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal PTEN(Ab-380/382/383) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of Serine 380 and Threonine 382/383. |
Rabbit Polyclonal ApoA1 Antibody
| Applications | WB |
| Reactivities | Chicken, Human |
| Conjugation | Unconjugated |
| Immunogen | ApoA1 antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human ApoA1. |
Rabbit anti-SERPINA1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SERPINA1 |
Rabbit polyclonal Anti-TPTE Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPTE antibody: synthetic peptide directed towards the middle region of human TPTE. Synthetic peptide located within the following region: YFAQVKHLYNWNLPPRRILFIKHFIIYSIPRYVRDLKIQIEMEKKVVFST |
Rabbit Polyclonal Anti-MBD4 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD4 antibody: synthetic peptide directed towards the middle region of human MBD4. Synthetic peptide located within the following region: CSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGTKVEVVERKEHLHT |
Rabbit Polyclonal Anti-TPTE Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPTE antibody: synthetic peptide directed towards the C terminal of human TPTE. Synthetic peptide located within the following region: KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL |
Rabbit Polyclonal Anti-HLA-A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-A antibody is: synthetic peptide directed towards the N-terminal region of Human HLA-A. Synthetic peptide located within the following region: SDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQ |
Rabbit anti pTEN(pS380) Polyclonal Antibody
| Applications | Dot, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -DTSDP-- with phosphorylation sites at Ser385 of PTEN protein from human, mouse and rat origins. |
Rabbit anti pTEN (Paired S380) Polyclonal Antibody
| Applications | Dot, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -DTSDP—without a phosphorylation site at Ser385 of human PTEN protein. This sequence is identical among human, mouse, rat , bovine and chicken origins. |
Goat Polyclonal Antibody against Calretinin
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence STVHEILCKLSLEGD, from the N Terminus of the protein sequence according to NP_001002858.1; NP_004030.1; NP_001002857.1. |
Goat Anti-APOA1BP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence PPYPDTECVYRLQ, from the C Terminus of the protein sequence according to NP_658985.2. |
Rabbit Polyclonal Caspase-8 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Caspase-8 antibody was raised against a 15 amino acid peptide from near the carboxy terminus human caspase-8 isoform E. |
Rabbit Polyclonal PTEN Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | PTEN antibody was raised against a 16 amino acid peptide from near the carboxy-terminus of human PTEN. |
Rabbit polyclonal TGF beta Receptor II antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β Receptor II antibody. |
Rabbit polyclonal anti-ASF1B antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ASF1B. |
Rabbit polyclonal Alpha-1-Trypsin antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Human Alpha-1-anti-Trypsin |
Rabbit polyclonal anti-PTEN-P1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to amino acids near the N-terminal end of human PTEN-P1 protein. |
Goat Anti-prealbumin / transthyretin (aa62-74) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EPFASGKTSESGE, from the internal region of the protein sequence according to NP_000362.1. |
Goat Anti-alpha-1-antitrypsin Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QKTDTSHHDQDHP, from the internal region (near N terminus) of the protein sequence according to NP_000286.3. |
Goat Anti-alpha-1-antitrypsin (aa230-241) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EDFHVDQVTTVK, from the internal region of the protein sequence according to NP_000286.3. |
Rabbit Polyclonal anti-PP2447 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PP2447 antibody: synthetic peptide directed towards the N terminal of human PP2447. Synthetic peptide located within the following region: MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMK |
Active filters
Reactivities
- Human
Filter by
Category
Target Symbol
- CD274 (140)
- PDCD1LG2 (79)
- ERBB3 (63)
- KRAS (58)
- SERPINA1 (47)
- CFLAR (33)
- PTEN (25)
- ASF1B (23)
- HLA-A (22)
- GC (20)
- TGFBR2 (19)
- CASP8 (17)
- TTR (11)
- ANXA2 (10)
- TPTE (8)
- ARID1A (7)
- DEDD (7)
- APOA1 (6)
- CASP8AP2 (5)
- MBD4 (4)
- MED1 (4)
- NAXE (4)
- ANXA2R (3)
- C2ORF76 (2)
- HLA-A/B/C (2)
- SHKBP1 (2)
- HLA-A/F/H (1)
- HLA-B (1)
- PD-L1 (1)
Applications
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
Pathways
- Cell adhesion molecules (CAMs) (226)
- ErbB signaling pathway (117)
- Pathways in cancer (97)
- Endocytosis (95)
- Natural killer cell mediated cytotoxicity (72)
- Chronic myeloid leukemia (71)
- Colorectal cancer (71)
- MAPK signaling pathway (71)
- Pancreatic cancer (71)
- Endometrial cancer (69)
- Glioma (69)
- Melanoma (69)
- Prostate cancer (69)
- Tight junction (69)
- Calcium signaling pathway (62)
- Acute myeloid leukemia (55)
- Axon guidance (55)
- B cell receptor signaling pathway (55)
- Bladder cancer (55)
- Chemokine signaling pathway (55)
- Dorso-ventral axis formation (55)
- Fc epsilon RI signaling pathway (55)
- Gap junction (55)
- GnRH signaling pathway (55)
- Insulin signaling pathway (55)
- Long-term depression (55)
- Long-term potentiation (55)
- Melanogenesis (55)
- Neurotrophin signaling pathway (55)
- Non-small cell lung cancer (55)
- Progesterone-mediated oocyte maturation (55)
- Regulation of actin cytoskeleton (55)
- Renal cell carcinoma (55)
- T cell receptor signaling pathway (55)
- Thyroid cancer (55)
- VEGF signaling pathway (55)
- Complement and coagulation cascades (46)
- Apoptosis (44)
- Viral myocarditis (29)
- p53 signaling pathway (26)
- Allograft rejection (17)
- Antigen processing and presentation (17)
- Autoimmune thyroid disease (17)
- Graft-versus-host disease (17)
- Type I diabetes mellitus (17)
- Adherens junction (16)
- Cytokine-cytokine receptor interaction (16)
- TGF-beta signaling pathway (16)
- Focal adhesion (14)
- Inositol phosphate metabolism (14)
- Phosphatidylinositol signaling system (14)
- Small cell lung cancer (14)
- Alzheimer's disease (12)
- Huntington's disease (12)
- NOD-like receptor signaling pathway (12)
- RIG-I-like receptor signaling pathway (12)
- Toll-like receptor signaling pathway (12)
- PPAR signaling pathway (4)
- Base excision repair (2)