Rabbit Polyclonal anti-TRABD antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRABD antibody: synthetic peptide directed towards the middle region of human TRABD. Synthetic peptide located within the following region: LCFLSDPISKDDVERCKQKDLLEQMMAEMIGEFPDLHRTIVSERDVYLTY |
Rabbit Polyclonal Anti-TGFBR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TGFBR2 Antibody: synthetic peptide directed towards the N terminal of human TGFBR2. Synthetic peptide located within the following region: MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIICPSCNRT |
Mouse Monoclonal Caspase-8 Antibody (FLICE 4-1-20)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SHKBP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SHKBP1 antibody is: synthetic peptide directed towards the N-terminal region of Human SHKBP1. Synthetic peptide located within the following region: TVFAPILNFLRTKELDPRGVHGSSLLHEAQFYGLTPLVRRLQLREELDRS |
Rabbit Polyclonal Anti-TPTE Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPTE antibody: synthetic peptide directed towards the middle region of human TPTE. Synthetic peptide located within the following region: IQIEMEKKVVFSTISLGKCSVLDNITTDKILIDVFDGLPLYDDVKVQFFY |
Rabbit Polyclonal Anti-ASF1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASF1B antibody: synthetic peptide directed towards the middle region of human ASF1B. Synthetic peptide located within the following region: YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH |
Rabbit Polyclonal Anti-CASP8AP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CASP8AP2 antibody: synthetic peptide directed towards the N terminal of human CASP8AP2. Synthetic peptide located within the following region: SLKKNISALIKTARVEINRKDEEISNLHQRLSEFPHFRNNHKTARTFDTV |
Rabbit Polyclonal Anti-ANXA2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANXA2 antibody: synthetic peptide directed towards the C terminal of human ANXA2. Synthetic peptide located within the following region: RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD |
Rabbit Polyclonal Anti-TPTE Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPTE antibody: synthetic peptide directed towards the C terminal of human TPTE. Synthetic peptide located within the following region: MNESPDPTDLAGVIIELGPNDSPQTSEFKGATEEAPAKESVLARLSKFEV |
Rabbit Polyclonal Anti-GC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GC antibody: synthetic peptide directed towards the N terminal of human GC. Synthetic peptide located within the following region: KHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLV |
Rabbit anti Caspase 8 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A recombinant full length human caspase 8 protein |
Rabbit anti c-erbB3 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse anti c-erbB-3/HER-3 Monoclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse anti MHC I (HLA-A,B,C) Monoclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti TGF beta Receptor II Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the internal sequence of human TGFbR2 |
Rabbit anti C-erbB3/HER3 (pY1283) Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti C-erbB3/HER3 (Paired Y1283) Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti C-erbB3/HER3 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-PD-L1 Antibody
| Reactivities | Cross-reacts with Human |
| Conjugation | Unconjugated |
USD 465.00
4 Weeks
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) CD274 mouse monoclonal antibody, clone OTI1B12 (formerly 1B12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) CD274 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD274 mouse monoclonal antibody, clone OTI2B12 (formerly 2B12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRAS mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRAS mouse monoclonal antibody, clone OTI3B12 (formerly 3B12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRAS mouse monoclonal antibody, clone OTI5H6 (formerly 5H6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRAS mouse monoclonal antibody, clone OTI4C6 (formerly 4C6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRAS mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRAS mouse monoclonal antibody, clone OTI4F6 (formerly 4F6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRAS mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRAS mouse monoclonal antibody, clone OTI8B4 (formerly 8B4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CFLAR mouse monoclonal antibody, clone OTI2D3 (formerly 2D3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
