ASF1B (Myc-DDK-tagged)-Human ASF1 anti-silencing function 1 homolog B (S. cerevisiae) (ASF1B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ASF1B (Myc-DDK-tagged)-Human ASF1 anti-silencing function 1 homolog B (S. cerevisiae) (ASF1B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Asf1b (Myc-DDK-tagged) - Mouse ASF1 anti-silencing function 1 homolog B (S. cerevisiae) (Asf1b)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ASF1B (GFP-tagged) - Human ASF1 anti-silencing function 1 homolog B (S. cerevisiae) (ASF1B)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ASF1B - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Asf1b - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Asf1b (GFP-tagged) - Mouse ASF1 anti-silencing function 1 homolog B (S
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Asf1b (Myc-DDK-tagged) - Mouse ASF1 anti-silencing function 1 homolog B (S. cerevisiae) (Asf1b)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Asf1b (Myc-DDK-tagged) - Mouse ASF1 anti-silencing function 1 homolog B (S. cerevisiae) (Asf1b), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Asf1b (mGFP-tagged) - Mouse ASF1 anti-silencing function 1 homolog B (S. cerevisiae) (Asf1b)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Asf1b (GFP-tagged) - Mouse ASF1 anti-silencing function 1 homolog B (S. cerevisiae) (Asf1b), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ASF1 anti-silencing function 1 homolog B (S. cerevisiae) (ASF1B), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ASF1B (Myc-DDK tagged) - Human ASF1 anti-silencing function 1 homolog B (S. cerevisiae) (ASF1B), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ASF1 anti-silencing function 1 homolog B (S. cerevisiae) (ASF1B), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ASF1B (mGFP-tagged) - Human ASF1 anti-silencing function 1 homolog B (S. cerevisiae) (ASF1B), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Asf1b (Myc-DDK-tagged ORF) - Rat ASF1 anti-silencing function 1 homolog B (S. cerevisiae) (Asf1b), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Asf1b (Myc-DDK-tagged ORF) - Rat ASF1 anti-silencing function 1 homolog B (S. cerevisiae) (Asf1b), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Asf1b (Myc-DDK-tagged ORF) - Rat ASF1 anti-silencing function 1 homolog B (S. cerevisiae) (Asf1b), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Asf1b (mGFP-tagged ORF) - Rat ASF1 anti-silencing function 1 homolog B (S. cerevisiae) (Asf1b), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Asf1b (GFP-tagged ORF) - Rat ASF1 anti-silencing function 1 homolog B (S. cerevisiae) (Asf1b), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ASF1B (untagged)-Human ASF1 anti-silencing function 1 homolog B (S. cerevisiae) (ASF1B)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
ASF1B - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
Asf1b (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
ASF1B mouse monoclonal antibody, clone AT1D4, Purified
Applications | ELISA, WB |
Reactivities | Human |
ASF1B mouse monoclonal antibody, clone AT1D4, Purified
Applications | ELISA, WB |
Reactivities | Human |
ASF1B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Asf1b (untagged) - Mouse ASF1 anti-silencing function 1 homolog B (S. cerevisiae) (Asf1b), (10ug)
Vector | PCMV6-Kan/Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-ASF1B antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ASF1B. |
Rabbit Polyclonal Anti-ASF1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ASF1B antibody: synthetic peptide directed towards the middle region of human ASF1B. Synthetic peptide located within the following region: YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH |
ASF1B (1-202, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
ASF1B (1-202, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) ASF1B mouse monoclonal antibody,clone OTI1H5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASF1B mouse monoclonal antibody,clone OTI2D1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASF1B mouse monoclonal antibody,clone OTI1E9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASF1B mouse monoclonal antibody,clone OTI4A4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ASF1B CRISPRa kit - CRISPR gene activation of human anti-silencing function 1B histone chaperone
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Asf1b CRISPRa kit - CRISPR gene activation of mouse anti-silencing function 1B histone chaperone
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene ASF1B
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene ASF1B
Transient overexpression lysate of ASF1 anti-silencing function 1 homolog B (S. cerevisiae) (ASF1B)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
qPCR primer pairs and template standards against Mus musculus gene Asf1b
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Asf1b
ASF1B MS Standard C13 and N15-labeled recombinant protein (NP_060624)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Asf1b (untagged ORF) - Rat ASF1 anti-silencing function 1 homolog B (S. cerevisiae) (Asf1b), (10 ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
3`UTR clone of ASF1 anti-silencing function 1 homolog B (S. cerevisiae) (ASF1B) for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
ASF1B (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Asf1b (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
ASF1B Antibody - middle region
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of rat ASF1B |
ASF1B Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 63-202 of human ASF1B (NP_060624.1). |
Modifications | Unmodified |
ASF1B mouse monoclonal antibody,clone OTI1H5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ASF1B mouse monoclonal antibody,clone OTI1H5, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |