CD11b (ITGAM) chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to a sequence shared between the Mouse (NP_001076429.1) and Human gene products (NP_001139280.1). After repeated injections, immune eggs were collected, and the IgY fractions were purified from the yolks. |
Rabbit Polyclonal Integrin alpha M/CD11b Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region (within residues 250-350) of the mouse CD11b protein. [Swiss-Prot# P05555] |
USD 390.00
2 Weeks
Integrin alpha 3 (ITGA3) (3A Isoform specific) mouse monoclonal antibody, clone 29A3, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
USD 390.00
2 Weeks
USD 390.00
2 Weeks
Integrin alpha 3 (ITGA3) (3B Isoform specific) mouse monoclonal antibody, clone 54B3, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
Rabbit polyclonal ITGAX Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ITGAX antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1119-1145 amino acids from the C-terminal region of human ITGAX. |
USD 390.00
2 Weeks
Rabbit polyclonal ITGA6 Antibody (isoform 2 S1064)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ITGA6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1043-1072 amino acids from human ITGA6. |
Rabbit Polyclonal Anti-ITGA2 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ITGA2 antibody is: synthetic peptide directed towards the C-terminal region of Human ITGA2. Synthetic peptide located within the following region: LQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINF |
Rabbit polyclonal CD18/ITGB2 (Thr758) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CD18/ITGB2 around the phosphorylation site of threonine 758 (S-A-TP-T-T). |
| Modifications | Phospho-specific |
Germany
Japan
United Kingdom
China
