Fluorescent Protein Antibodies

Jump to Filters
View as table Download
CD18 (ITGB2) Rabbit Monoclonal Antibody [Clone ID: EP1286Y]
TA300794

USD 506.00

In Stock

Rabbit Monoclonal Antibody against ITGB2 (Clone EP1286Y)

Applications WB
Reactivities Human
Conjugation Unconjugated
CD55 Rabbit Polyclonal Antibody
TA308396

USD 415.00

5 Days

Rabbit Polyclonal antibody to CD55 (CD55 molecule, decay accelerating factor for complement (Cromer blood group))

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 71 and 330 of CD55 (Uniprot ID#P08174)
CD55 Rabbit Polyclonal Antibody
TA313742

USD 345.00

In Stock

Rabbit polyclonal anti-CD55 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CD55.
CD18 (ITGB2) (N-term) Rabbit Polyclonal Antibody
AP23400PU-N

USD 405.00

2 Weeks

CD18 (ITGB2) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide mapping at the N-terminal of human Integrin β2
CD18 (ITGB2) Rabbit Polyclonal Antibody
TA311741

USD 345.00

4 Weeks

Rabbit polyclonal CD18/ITGB2 (Thr758) antibody(Phospho-specific)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CD18/ITGB2 around the phosphorylation site of threonine 758 (S-A-TP-T-T).
Modifications Phospho-specific
CD55 Rabbit Polyclonal Antibody
AP21156PU-N

USD 370.00

2 Weeks

CD55 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
CD18 (ITGB2) Goat Polyclonal Antibody
TA334177

USD 375.00

5 Days

Goat Anti-ITGB2 (aa86-99) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-ETQEDHNGGQKQLS, from the internal region of the protein sequence according to NP_000202.2.
CD55 Rabbit Polyclonal Antibody
TA342863

USD 375.00

5 Days

Rabbit Polyclonal Anti-CD55 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD55 antibody: synthetic peptide directed towards the middle region of human CD55. Synthetic peptide located within the following region: PGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGI
CD18 (ITGB2) Rabbit Polyclonal Antibody
TA350097

USD 345.00

In Stock

Rabbit Polyclonal Anti-ITGB2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ITGB2