Fluorescent Protein Antibodies

cDNA Clones (10)
Antibodies (5)
Proteins (1)
Jump to Filters
View as table Download
CD49b (ITGA2) (NM_002203) Human Tagged ORF Clone Lentiviral Particle
RC212617L1V

USD 1,640.00

3 Weeks

Lenti ORF particles, ITGA2 (Myc-DDK tagged) - Human integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor) (ITGA2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

CD49b (ITGA2) (NM_002203) Human Tagged ORF Clone Lentiviral Particle
RC212617L2V

USD 1,640.00

3 Weeks

Lenti ORF particles, ITGA2 (mGFP-tagged) - Human integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor) (ITGA2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

CD49b (ITGA2) (NM_002203) Human Tagged ORF Clone
RC212617

USD 1,240.00

In Stock

ITGA2 (Myc-DDK-tagged)-Human integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor) (ITGA2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CD49b (ITGA2) (NM_002203) Human Tagged ORF Clone
RG212617

USD 1,360.00

In Stock

ITGA2 (GFP-tagged) - Human integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor) (ITGA2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD49b (ITGA2) (NM_002203) Human Tagged ORF Clone
RC212617L3

USD 1,440.00

3 Weeks

Lenti ORF clone of Human integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor) (ITGA2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD49b (ITGA2) (NM_002203) Human Tagged ORF Clone Lentiviral Particle
RC212617L3V

USD 1,640.00

5 Weeks

Lenti ORF particles, ITGA2 (Myc-DDK tagged) - Human integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor) (ITGA2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

CD49b (ITGA2) (NM_002203) Human Tagged ORF Clone Lentiviral Particle
RC212617L4V

USD 1,640.00

5 Weeks

Lenti ORF particles, ITGA2 (mGFP-tagged) - Human integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor) (ITGA2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

CD49b (ITGA2) (NM_002203) Human Tagged ORF Clone
RC212617L1

USD 1,440.00

In Stock

Lenti ORF clone of Human integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor) (ITGA2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CD49b (ITGA2) (NM_002203) Human Tagged ORF Clone
RC212617L2

USD 1,440.00

In Stock

Lenti ORF clone of Human integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor) (ITGA2), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CD49b (ITGA2) (NM_002203) Human Untagged Clone
SC118747

USD 2,390.00

In Stock

ITGA2 (untagged)-Human integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor) (ITGA2)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
CD49b (ITGA2) Rabbit Polyclonal Antibody
TA338255

USD 375.00

5 Days

Rabbit Polyclonal Anti-ITGA2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ITGA2 antibody is: synthetic peptide directed towards the C-terminal region of Human ITGA2. Synthetic peptide located within the following region: LQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINF
CD49b (ITGA2) Rabbit Polyclonal Antibody
TA341147

USD 425.00

2 Weeks

Rabbit Polyclonal Anti-ITGA2 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen ITGA2 / CD49b antibody was raised against synthetic 14 amino acid peptide from extracellular domain of human ITGA2 / CD49b. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Gorilla, Marmoset, Mouse, Bovine, Elephant, Horse (93%); Rat, Panda, Pig (86%).
CD49b (ITGA2) (NM_002203) Human Recombinant Protein
TP762237

USD 205.00

In Stock

Purified recombinant protein of Human integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor) (ITGA2), Asp203-Val466, with N-terminal His tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli
CD49b (ITGA2) (C-term) Rabbit Polyclonal Antibody
AP52250PU-N

USD 450.00

2 Weeks

CD49b (ITGA2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1029~1058 amino acids from the C-terminal region of human CD49b / ITGA2
CD49b (ITGA2) Rabbit Polyclonal Antibody
TA341148

USD 425.00

5 Days

Rabbit Polyclonal Anti-ITGA2 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen ITGA2 / CD49b antibody was raised against synthetic 16 amino acid peptide from extracellular domain of human ITGA2 / CD49b. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog, Panda, Pig (100%); Bovine, Elephant, Horse, Chicken, Lizard (94%); Opossum, Turkey (88%); Bat, Hamster, Stickleback (81%).
CD49b (ITGA2) Rabbit Polyclonal Antibody
TA350748

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-ITGA2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ITGA2