Research Areas

Jump to Filters
View as table Download
TNF alpha (TNF) Rabbit Polyclonal Antibody
AP20373PU-N

USD 370.00

In Stock

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.
HLAG (HLA-G) Rabbit Polyclonal Antibody
TA325084

USD 450.00

2 Weeks

Rabbit polyclonal HLA-G Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G.
IL1 beta (IL1B) Rabbit Polyclonal Antibody
TA336742

USD 424.00

2 Weeks

Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminal portion of the human IL 1 beta protein (between amino acids 100-200) [UniProt P01584]
IL1 beta (IL1B) Rabbit Polyclonal Antibody
AP20628PU-N

USD 370.00

2 Weeks

IL1 beta (IL1B) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 131-180 of Human IL-1 Beta
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA313322

USD 345.00

In Stock

Rabbit polyclonal anti-TNFA antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNFA.
IL1 beta (IL1B) Rabbit Polyclonal Antibody
TA326933

USD 275.00

3 Weeks

Rabbit anti-IL1B Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human IL1B
HLA-DOA Rabbit Polyclonal Antibody
AP21064PU-N

USD 370.00

2 Weeks

HLA-DOA rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
IL12B (C-term) Rabbit Polyclonal Antibody
AP52183PU-N

USD 450.00

2 Weeks

IL12B (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 271-298aa) of human Interleukin-12 beta/IL12B.
HLA DMB (HLA-DMB) Rabbit Polyclonal Antibody
TA308239

USD 415.00

5 Days

Rabbit polyclonal antibody to HLA-DMB (major histocompatibility complex, class II, DM beta)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 199 and 263 of HLA-DMB (Uniprot ID#P28068)
HLAB (HLA-B) Rabbit Polyclonal Antibody
TA325053

USD 450.00

5 Days

Rabbit polyclonal HLA-B Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HLA-B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-90 amino acids from the N-terminal region of human HLA-B.
HLAF (HLA-F) Rabbit Polyclonal Antibody
TA331071

USD 375.00

5 Days

Rabbit polyclonal Anti-HLA-F Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT
IL2 Rabbit Polyclonal Antibody
AP17501PU-N

USD 450.00

2 Weeks

IL2 rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between aa 57-86 from the Center region of Human IL2
HLA-DRB5 (Center) Rabbit Polyclonal Antibody
AP52055PU-N

USD 450.00

2 Weeks

HLA-DRB5 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 43~70 amino acids from the Central region of human HLA class II DRB5 beta / HLA-DRB5
HLA DM (HLA-DMA) Rabbit Polyclonal Antibody
TA308310

USD 415.00

5 Days

Rabbit polyclonal antibody to HLA-DMA (major histocompatibility complex, class II, DM alpha)

Applications IHC, WB
Reactivities Human
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 52 and 245 of HLA-DMA
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA319289

USD 1,380.00

5 Days

Rabbit polyclonal TNF Alpha antibody

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA319290

USD 1,380.00

5 Days

Rabbit polyclonal TNF alpha antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA336738

USD 479.00

5 Days

Rabbit Polyclonal TNF-alpha Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375]
IL1 beta (IL1B) Rabbit Polyclonal Antibody
TA321162

USD 345.00

In Stock

Anti-IL1B Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA323618

USD 345.00

In Stock

Anti-TNF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 57-233 amino acids of human tumor necrosis factor
HLA-DPB1 Rabbit Polyclonal Antibody
TA358394

USD 360.00

5 Days

HLA-DPB1 Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
HLA DMB (HLA-DMB) Rabbit Polyclonal Antibody
TA358412

USD 360.00

5 Days

HLA-DMB Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated