Research Areas

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 38 of 38 results

(reset)

HLAG (HLA-G) Rabbit Polyclonal Antibody

TA325084

USD 450.00

2 Weeks

Rabbit polyclonal HLA-G Antibody (Center)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G.

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

IL10 (Center) Rabbit Polyclonal Antibody

AP52181PU-N

USD 450.00

2 Weeks

IL10 (Center) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IHC, WB
Reactivities	Human
Immunogen	Synthetic peptide - KLH conjugated corresponding to the center region (between aa 27-53) of Human IL10.

1 / 3

2 / 3

3 / 3

Previous Next

IL10 Rabbit Polyclonal Antibody

PP1032P1

USD 260.00

2 Weeks

IL10 rabbit polyclonal antibody, Aff - Purified

Applications	ELISA, FN, IHC, WB
Reactivities	Human
Immunogen	Highly pure (>98%) E.coli derived recombinant Human IL-10 (Cat.-No PA084)

1 / 3

2 / 3

3 / 3

Previous Next

IL4 Rabbit Polyclonal Antibody

PP1026P2

USD 355.00

2 Weeks

IL4 rabbit polyclonal antibody, Aff - Purified

Applications	ELISA, FN, IHC, WB
Reactivities	Human
Immunogen	Highly pure (>98%) recombinant hIL-4 (human IL-4)

IL10 Rabbit Polyclonal Antibody

PP1032P2

USD 355.00

2 Weeks

IL10 rabbit polyclonal antibody, Aff - Purified

Applications	ELISA, FN, IHC, WB
Reactivities	Human
Immunogen	Highly pure (>98%) E.coli derived recombinant Human IL-10 (Cat.-No PA084)

1 / 3

2 / 3

3 / 3

Previous Next

HLA-DOA Rabbit Polyclonal Antibody

AP21064PU-N

USD 370.00

2 Weeks

HLA-DOA rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human

1 / 2

2 / 2

Previous Next

IL4 Rabbit Polyclonal Antibody

PP1026P1

USD 260.00

2 Weeks

IL4 rabbit polyclonal antibody, Aff - Purified

Applications	ELISA, IHC, WB
Reactivities	Human
Immunogen	Highly pure (>98%) recombinant hIL-4 (human IL-4)

HLA DMB (HLA-DMB) Rabbit Polyclonal Antibody

TA308239

USD 415.00

5 Days

Rabbit polyclonal antibody to HLA-DMB (major histocompatibility complex, class II, DM beta)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region within amino acids 199 and 263 of HLA-DMB (Uniprot ID#P28068)

1 / 2

2 / 2

Previous Next

IL4 Rabbit Polyclonal Antibody

TA324803

USD 450.00

5 Days

Rabbit polyclonal IL4 Antibody (C-term)

Applications	FC, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	This L4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-150 amino acids from the C-terminal region of human L4.

1 / 3

2 / 3

3 / 3

Previous Next

HLAB (HLA-B) Rabbit Polyclonal Antibody

TA325053

USD 450.00

5 Days

Rabbit polyclonal HLA-B Antibody (N-term)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This HLA-B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-90 amino acids from the N-terminal region of human HLA-B.

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

HLAF (HLA-F) Rabbit Polyclonal Antibody

TA331071

USD 375.00

5 Days

Rabbit polyclonal Anti-HLA-F Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT

1 / 2

2 / 2

Previous Next

IL2 Rabbit Polyclonal Antibody

AP17501PU-N

USD 450.00

2 Weeks

IL2 rabbit polyclonal antibody, Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between aa 57-86 from the Center region of Human IL2

1 / 2

2 / 2

Previous Next

HLA-DRB5 (Center) Rabbit Polyclonal Antibody

AP52055PU-N

USD 450.00

2 Weeks

HLA-DRB5 (Center) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 43~70 amino acids from the Central region of human HLA class II DRB5 beta / HLA-DRB5

1 / 2

2 / 2

Previous Next

HLAG (HLA-G) Mouse Monoclonal Antibody [Clone ID: MEM-G/1]

SM1591B

USD 385.00

2 Weeks

HLAG (HLA-G) mouse monoclonal antibody, clone MEM-G/1, Biotin

Applications	IHC, WB
Reactivities	Human
Conjugation	Biotin

1 / 2

2 / 2

Previous Next

HLA DM (HLA-DMA) Rabbit Polyclonal Antibody

TA308310

USD 415.00

5 Days

Rabbit polyclonal antibody to HLA-DMA (major histocompatibility complex, class II, DM alpha)

Applications	IHC, WB
Reactivities	Human
Immunogen	Recombinant protein fragment contain a sequence corresponding to a region within amino acids 52 and 245 of HLA-DMA

1 / 3

2 / 3

3 / 3

Previous Next

IL2 Mouse Monoclonal Antibody [Clone ID: OTI2C9]

CF810724

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) IL2 mouse monoclonal antibody,clone OTI2C9

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

IL2 Mouse Monoclonal Antibody [Clone ID: OTI5A9]

CF810802

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) IL2 mouse monoclonal antibody,clone OTI5A9

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

HLA-DRB5 Mouse Monoclonal Antibody [Clone ID: OTI4G7]

CF812174

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) HLA mouse monoclonal antibody,clone OTI4G7

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

HLA-DPB1 Rabbit Polyclonal Antibody

TA358394

USD 360.00

5 Days

HLA-DPB1 Antibody - middle region

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

HLA DMB (HLA-DMB) Rabbit Polyclonal Antibody

TA358412

USD 360.00

5 Days

HLA-DMB Antibody - N-terminal region

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

IL2 Mouse Monoclonal Antibody [Clone ID: OTI2C9]

TA810724

USD 379.00

In Stock

IL2 mouse monoclonal antibody,clone OTI2C9

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

IL2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C9]

TA810724AM

USD 420.00

4 Weeks

IL2 mouse monoclonal antibody,clone OTI2C9, Biotinylated

Applications	IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 3

2 / 3

3 / 3

Previous Next

IL2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C9]

TA810724BM

USD 420.00

4 Weeks

IL2 mouse monoclonal antibody,clone OTI2C9, HRP conjugated

Applications	IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 3

2 / 3

3 / 3

Previous Next

IL2 Mouse Monoclonal Antibody [Clone ID: OTI2C9]

TA810724S

USD 159.00

2 Days

IL2 mouse monoclonal antibody,clone OTI2C9

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

IL2 Mouse Monoclonal Antibody [Clone ID: OTI5A9]

TA810802

USD 379.00

In Stock

IL2 mouse monoclonal antibody,clone OTI5A9

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

IL2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5A9]

TA810802AM

USD 420.00

4 Weeks

IL2 mouse monoclonal antibody,clone OTI5A9, Biotinylated

Applications	IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 3

2 / 3

3 / 3

Previous Next

IL2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5A9]

TA810802BM

USD 420.00

4 Weeks

IL2 mouse monoclonal antibody,clone OTI5A9, HRP conjugated

Applications	IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 3

2 / 3

3 / 3

Previous Next

IL2 Mouse Monoclonal Antibody [Clone ID: OTI5A9]

TA810802S

USD 159.00

2 Days

IL2 mouse monoclonal antibody,clone OTI5A9

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

HLA-DRB5 Mouse Monoclonal Antibody [Clone ID: OTI4G7]

TA812174

USD 379.00

In Stock

HLA mouse monoclonal antibody,clone OTI4G7

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

HLA-DRB5 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G7]

TA812174AM

USD 420.00

4 Weeks

HLA mouse monoclonal antibody,clone OTI4G7, Biotinylated

Applications	IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

HLA-DRB5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G7]

TA812174BM

USD 420.00

4 Weeks

HLA mouse monoclonal antibody,clone OTI4G7, HRP conjugated

Applications	IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

HLA-DRB5 Mouse Monoclonal Antibody [Clone ID: OTI4G7]

TA812174S

USD 159.00

2 Days

HLA mouse monoclonal antibody,clone OTI4G7

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

HLA-DQA2 Mouse Monoclonal Antibody [Clone ID: OTI3E6]

TA812935S

USD 159.00

2 Days

HLA-DQA2 mouse monoclonal antibody,clone OTI3E6

Applications	WB
Reactivities	Human
Conjugation	Unconjugated

• 

HLA-DQA2 Mouse Monoclonal Antibody [Clone ID: OTI4C9]

TA812936S

USD 159.00

2 Days

HLA-DQA2 mouse monoclonal antibody,clone OTI4C9

Applications	WB
Reactivities	Human
Conjugation	Unconjugated

• 

IL10 Mouse Monoclonal Antibody [Clone ID: OTI9H3]

TA813305S

USD 159.00

2 Days

IL10 mouse monoclonal antibody,clone OTI9H3

Applications	WB
Reactivities	Human
Conjugation	Unconjugated

• 

HLAA (HLA-A) Mouse Monoclonal Antibody [Clone ID: OTI4D11]

TA813375S

USD 159.00

2 Days

HLA mouse monoclonal antibody, clone OTI4D11

Applications	WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

HLAA (HLA-A) Mouse Monoclonal Antibody [Clone ID: OTI2D11]

TA813378S

USD 159.00

2 Days

HLA mouse monoclonal antibody, clone OTI2D11

Applications	WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

HLAA (HLA-A) Mouse Monoclonal Antibody [Clone ID: OTI3H6]

TA813379S

USD 159.00

2 Days

HLA mouse monoclonal antibody, clone OTI3H6

Applications	WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

1 - 38 of 38 results