Research Areas

View as table Download

Phospho-RAC1-S71 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S71 of human RAC1

Rabbit Polyclonal ROCK1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ROCK1

Rabbit Polyclonal ROCK2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ROCK2 antibody was raised against a 15 amino acid synthetic peptide near the center of human ROCK2.

Rabbit Polyclonal ROCK2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ROCK2

Rabbit polyclonal ROCK2 (Ab-722) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human ROCK2 around the phosphorylation site of tyrosine 722 (K-I-YP-E-S).

Rabbit Polyclonal ROCK1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ROCK1 antibody was raised against a 15 amino acid synthetic peptide near the amino terminus of human ROCK1.

Rabbit Polyclonal Anti-NFATC3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NFATC3 antibody: synthetic peptide directed towards the N terminal of human NFATC3. Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI

Mouse Monoclonal cleaved ROCK1 Antibody (154C1465)

Applications WB
Reactivities Human, Mouse, Rat, Canine, Primate, Rabbit
Conjugation Unconjugated

Rabbit anti Rho Kinase/ROCKII (pT396) Polyclonal Antibody

Applications WB
Reactivities Bovine, Chicken, Human, Mouse, Rat, Canis
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope -VETFP- with a single phosphorylation site Thr396 of human RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine.

Rabbit anti Rho Kinase/ROCKII (Paired T396) Polyclonal Antibody

Applications WB
Reactivities Bovine, Chicken, Human, Mouse, Rat, Canis
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope -VETFP- without a phosphorylation site Thr396 of human RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine.

Rabbit anti Rho Kinase/ROCKII (IN) Polyclonal Antibody

Applications WB
Reactivities Bovine, Chicken, Human, Mouse, Rat, Canis
Conjugation Unconjugated
Immunogen A synthetic peptide (19mer) derived from 250-350 amino acids of human RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine.

Rabbit anti Rho Kinase/ROCKII (pT249) Polyclonal Antibody

Applications WB
Reactivities Bovine, Chicken, Human, Mouse, Rat, Canis
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope -CDTAV- with a single phosphorylation site Thr249 of human Rho Kinase/RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine.

Rabbit anti Rho Kinase/ROCKII (Paired T249) Polyclonal Antibody

Applications WB
Reactivities Bovine, Chicken, Human, Mouse, Rat, Canis
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope -CDTAV- without a phosphorylation site Thr396 of human RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine.

Anti-ROCK2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human Rho-associated, coiled-coil containing protein kinase 2

ROCK2 Antibody - middle region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

PTK2 (FAK) mouse monoclonal antibody, clone OTI4A8 (formerly 4A8)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PAK4 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated