Research Areas

View as table Download

Rabbit Polyclonal IL-36RN Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen IL-36RN antibody was raised against a 19 amino acid peptide near the carboxy terminus of human IL-36RN.

Rabbit polyclonal Anti-Il1f5 Antibody

Applications WB
Reactivities Rat
Immunogen The immunogen for anti-Il1f5 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LGTKESKSFTFYRRDLGLTSSFESAAYPGWFLCTSPEADQPVRLTQISED

Rabbit polyclonal Anti-IL1F5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL1F5 antibody: synthetic peptide directed towards the middle region of human IL1F5. Synthetic peptide located within the following region: LTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD