Germany
Japan
United Kingdom
China
Research Areas
View as table Download
Rabbit anti-IL1B Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL1B |
Rabbit polyclonal Caspase 1 (Cleaved-Asp210) antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 1. |
Rabbit polyclonal Caspase 1 (Ser376) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 1 around the phosphorylation site of serine 376 (R-F-SP-F-E). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-IL33 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL33 antibody: synthetic peptide directed towards the N terminal of human IL33. Synthetic peptide located within the following region: AKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAAC |
Rabbit polyclonal anti-IL-6 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This whole rabbit serum was prepared by repeated immunizations with recombinant human IL-6 produced in E.coli. |
Rabbit Polyclonal Anti-IL6 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL6 antibody was raised against synthetic 18 amino acid peptide from internal region of human IL-6. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%). |
Mouse anti IL-6 Monoclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI3G9 (formerly 3G9)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI10C5
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI12C12
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI1D11
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI1E9
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI2B7
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI2E9
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI2G5
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI7D1
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI2B10
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI6D1
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI6D3
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI7A4
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI8C8
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI12E5
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI2B12
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI3A3A8
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI4C4
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI7D8
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI2B8
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI12C5
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI5G7
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI1A6
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI1D9
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI2B3
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI10A1
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI3B3
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI3A4
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI2C11
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI3E5
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI3A3B1
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI2G10
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI2A6
Active filters
Category
- Antibodies
Reactivities
- Human
Pathways
- Cytosolic DNA-sensing pathway