Research Areas

Antibodies (43)
cDNA Clones (27)
Proteins (13)
Jump to Filters
View as table Download
Dishevelled 2 (DVL2) (NM_004422) Human Tagged ORF Clone
RC202233

USD 610.00

In Stock

DVL2 (Myc-DDK-tagged)-Human dishevelled, dsh homolog 2 (Drosophila) (DVL2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
DVL1 (NM_182779) Human Tagged ORF Clone
RC208406

USD 470.00

In Stock

DVL1 (Myc-DDK-tagged)-Human dishevelled, dsh homolog 1 (Drosophila) (DVL1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Dishevelled 2 (DVL2) (NM_004422) Human Tagged ORF Clone
RG202233

USD 670.00

In Stock

DVL2 (GFP-tagged) - Human dishevelled, dsh homolog 2 (Drosophila) (DVL2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Dishevelled 3 (DVL3) (NM_004423) Human Tagged ORF Clone
RC207100

USD 610.00

In Stock

DVL3 (Myc-DDK-tagged)-Human dishevelled, dsh homolog 3 (Drosophila) (DVL3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Dishevelled 3 (DVL3) (NM_004423) Human Tagged ORF Clone
RG207100

USD 670.00

In Stock

DVL3 (GFP-tagged) - Human dishevelled, dsh homolog 3 (Drosophila) (DVL3)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Dishevelled 3 (DVL3) (NM_004423) Human Untagged Clone
SC117370

USD 310.00

In Stock

DVL3 (untagged)-Human dishevelled, dsh homolog 3 (Drosophila) (DVL3)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
DVL1 (NM_182779) Human Tagged ORF Clone
RG208406

USD 520.00

2 Weeks

DVL1 (GFP-tagged) - Human dishevelled, dsh homolog 1 (Drosophila) (DVL1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Dishevelled 2 (DVL2) (NM_004422) Human Tagged ORF Clone Lentiviral Particle
RC202233L3V

USD 1,010.00

5 Weeks

Lenti ORF particles, DVL2 (Myc-DDK tagged) - Human dishevelled, dsh homolog 2 (Drosophila) (DVL2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Dishevelled 2 (DVL2) (NM_004422) Human Tagged ORF Clone
RC202233L4

USD 810.00

3 Weeks

Lenti ORF clone of Human dishevelled, dsh homolog 2 (Drosophila) (DVL2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Dishevelled 3 (DVL3) (NM_004423) Human Tagged ORF Clone Lentiviral Particle
RC207100L3V

USD 1,010.00

5 Weeks

Lenti ORF particles, DVL3 (Myc-DDK tagged) - Human dishevelled, dsh homolog 3 (Drosophila) (DVL3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Dishevelled 3 (DVL3) (NM_004423) Human Tagged ORF Clone
RC207100L4

USD 810.00

3 Weeks

Lenti ORF clone of Human dishevelled, dsh homolog 3 (Drosophila) (DVL3), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DVL1 (NM_182779) Human Tagged ORF Clone
RC208406L3

USD 670.00

3 Weeks

Lenti ORF clone of Human dishevelled, dsh homolog 1 (Drosophila) (DVL1), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DVL1 (NM_182779) Human Tagged ORF Clone Lentiviral Particle
RC208406L3V

USD 870.00

6 Weeks

Lenti ORF particles, DVL1 (Myc-DDK tagged) - Human dishevelled, dsh homolog 1 (Drosophila) (DVL1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DVL1 (NM_182779) Human Tagged ORF Clone
RC208406L4

USD 670.00

3 Weeks

Lenti ORF clone of Human dishevelled, dsh homolog 1 (Drosophila) (DVL1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DVL1 (NM_182779) Human Tagged ORF Clone Lentiviral Particle
RC208406L4V

USD 870.00

6 Weeks

Lenti ORF particles, DVL1 (mGFP-tagged) - Human dishevelled, dsh homolog 1 (Drosophila) (DVL1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Dishevelled 2 (DVL2) (NM_004422) Human Untagged Clone
SC128046

USD 310.00

In Stock

DVL2 (untagged)-Human dishevelled, dsh homolog 2 (Drosophila) (DVL2)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
DVL1 (NM_182779) Human Untagged Clone
SC322649

USD 900.00

In Stock

DVL1 (untagged)-Human dishevelled, dsh homolog 1 (Drosophila) (DVL1), transcript variant 3

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Dishevelled 2 (DVL2) (NM_004422) Human Over-expression Lysate
LY401405

USD 396.00

In Stock

Transient overexpression lysate of dishevelled, dsh homolog 2 (Drosophila) (DVL2)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Dishevelled 2 (DVL2) (NM_004422) Human Over-expression Lysate
LC401405

USD 121.00

In Stock

DVL2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Dishevelled 2 (DVL2) (NM_004422) Human Tagged ORF Clone
RC202233L2

USD 810.00

3 Weeks

Lenti ORF clone of Human dishevelled, dsh homolog 2 (Drosophila) (DVL2), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Dishevelled 3 (DVL3) (NM_004423) Human Tagged ORF Clone
RC207100L2

USD 810.00

3 Weeks

Lenti ORF clone of Human dishevelled, dsh homolog 3 (Drosophila) (DVL3), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Dishevelled 3 (DVL3) Rabbit Polyclonal Antibody
TA324462

USD 450.00

5 Days

Rabbit polyclonal DVL3 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This DVL3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 530-557 amino acids from the C-terminal region of human DVL3.
Dishevelled 3 (DVL3) Rabbit Polyclonal Antibody
TA590632

USD 409.00

In Stock

Rabbit Polyclonal Dishevelled 3 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
Dishevelled 2 (DVL2) Rabbit Polyclonal Antibody
TA329901

USD 375.00

5 Days

Rabbit Polyclonal Anti-DVL2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DVL2 antibody: synthetic peptide directed towards the N terminal of human DVL2. Synthetic peptide located within the following region: AGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPA
Dishevelled 2 (DVL2) (C-term) Rabbit Polyclonal Antibody
AP51345PU-N

USD 450.00

2 Weeks

Dishevelled 2 (DVL2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 587-617 amino acids from the C-terminal region of Human DVL2.
DVL1 (NM_182779) Human Over-expression Lysate
LY405356

USD 396.00

5 Days

Transient overexpression lysate of dishevelled, dsh homolog 1 (Drosophila) (DVL1), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Dishevelled 2 (DVL2) Rabbit Polyclonal Antibody
TA313775

USD 345.00

4 Weeks

Rabbit polyclonal anti-DVL2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human DVL2.
Dishevelled 3 (DVL3) Rabbit Polyclonal Antibody
TA318951

USD 355.00

3 Weeks

Rabbit polyclonal anti-Dvl3 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 583 of mouse Dvl3
Dishevelled 2 (DVL2) Rabbit Polyclonal Antibody
TA329902

USD 375.00

5 Days

Rabbit Polyclonal Anti-DVL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DVL2 antibody is: synthetic peptide directed towards the middle region of Human DVL2. Synthetic peptide located within the following region: HRTGGPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQ
Dishevelled 2 (DVL2) Mouse Monoclonal Antibody [Clone ID: OTI7A3]
CF806788

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI7A3 (formerly 7A3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Dishevelled 2 (DVL2) Mouse Monoclonal Antibody [Clone ID: OTI7C7]
CF806789

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI7C7 (formerly 7C7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Dishevelled 2 (DVL2) Mouse Monoclonal Antibody [Clone ID: OTI1E11]
CF806790

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Dishevelled 2 (DVL2) Mouse Monoclonal Antibody [Clone ID: OTI2D11]
CF806791

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Dishevelled 2 (DVL2) Mouse Monoclonal Antibody [Clone ID: OTI1B12]
CF806832

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI1B12 (formerly 1B12)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Dishevelled 2 (DVL2) Mouse Monoclonal Antibody [Clone ID: OTI2E11]
CF806917

USD 465.00

In Stock

Carrier-free (glycerol/BSA-free) DVL2 mouse monoclonal antibody, clone OTI2E11 (formerly 2E11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Dishevelled 2 (DVL2) Mouse Monoclonal Antibody [Clone ID: OTI7F10]
CF806918

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI7F10 (formerly 7F10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
DVL1 (NM_182779) Human Over-expression Lysate
LC405356

USD 121.00

2 Weeks

DVL1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Dishevelled 2 (DVL2) Rabbit Polyclonal Antibody
TA350653

USD 345.00

In Stock

Rabbit Polyclonal Anti-DVL2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human DVL2
Dishevelled 2 (DVL2) Mouse Monoclonal Antibody [Clone ID: OTI7A3]
TA806788

USD 379.00

In Stock

DVL2 mouse monoclonal antibody, clone OTI7A3 (formerly 7A3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Dishevelled 2 (DVL2) Mouse Monoclonal Antibody [Clone ID: OTI7A3]
TA806788S

USD 159.00

2 Days

DVL2 mouse monoclonal antibody, clone OTI7A3 (formerly 7A3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated