DVL2 (Myc-DDK-tagged)-Human dishevelled, dsh homolog 2 (Drosophila) (DVL2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
DVL2 (Myc-DDK-tagged)-Human dishevelled, dsh homolog 2 (Drosophila) (DVL2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
DVL1 (Myc-DDK-tagged)-Human dishevelled, dsh homolog 1 (Drosophila) (DVL1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
DVL2 (GFP-tagged) - Human dishevelled, dsh homolog 2 (Drosophila) (DVL2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
DVL3 (Myc-DDK-tagged)-Human dishevelled, dsh homolog 3 (Drosophila) (DVL3)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,010.00
3 Weeks
Lenti ORF particles, DVL2 (Myc-DDK tagged) - Human dishevelled, dsh homolog 2 (Drosophila) (DVL2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 1,010.00
6 Weeks
Lenti ORF particles, DVL2 (mGFP-tagged) - Human dishevelled, dsh homolog 2 (Drosophila) (DVL2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 1,010.00
3 Weeks
Lenti ORF particles, DVL3 (Myc-DDK tagged) - Human dishevelled, dsh homolog 3 (Drosophila) (DVL3), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 1,010.00
6 Weeks
Lenti ORF particles, DVL3 (mGFP-tagged) - Human dishevelled, dsh homolog 3 (Drosophila) (DVL3), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
DVL3 (GFP-tagged) - Human dishevelled, dsh homolog 3 (Drosophila) (DVL3)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
DVL3 (untagged)-Human dishevelled, dsh homolog 3 (Drosophila) (DVL3)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
DVL1 (GFP-tagged) - Human dishevelled, dsh homolog 1 (Drosophila) (DVL1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human dishevelled, dsh homolog 2 (Drosophila) (DVL2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,010.00
5 Weeks
Lenti ORF particles, DVL2 (Myc-DDK tagged) - Human dishevelled, dsh homolog 2 (Drosophila) (DVL2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human dishevelled, dsh homolog 2 (Drosophila) (DVL2), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,010.00
7 Weeks
Lenti ORF particles, DVL2 (mGFP-tagged) - Human dishevelled, dsh homolog 2 (Drosophila) (DVL2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human dishevelled, dsh homolog 3 (Drosophila) (DVL3), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,010.00
5 Weeks
Lenti ORF particles, DVL3 (Myc-DDK tagged) - Human dishevelled, dsh homolog 3 (Drosophila) (DVL3), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human dishevelled, dsh homolog 3 (Drosophila) (DVL3), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,010.00
7 Weeks
Lenti ORF particles, DVL3 (mGFP-tagged) - Human dishevelled, dsh homolog 3 (Drosophila) (DVL3), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human dishevelled, dsh homolog 1 (Drosophila) (DVL1), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, DVL1 (Myc-DDK tagged) - Human dishevelled, dsh homolog 1 (Drosophila) (DVL1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human dishevelled, dsh homolog 1 (Drosophila) (DVL1), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, DVL1 (mGFP-tagged) - Human dishevelled, dsh homolog 1 (Drosophila) (DVL1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
DVL2 (untagged)-Human dishevelled, dsh homolog 2 (Drosophila) (DVL2)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
DVL1 (untagged)-Human dishevelled, dsh homolog 1 (Drosophila) (DVL1), transcript variant 3
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of dishevelled, dsh homolog 2 (Drosophila) (DVL2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
DVL2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Lenti ORF clone of Human dishevelled, dsh homolog 2 (Drosophila) (DVL2), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human dishevelled, dsh homolog 3 (Drosophila) (DVL3), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal DVL3 Antibody (C-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This DVL3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 530-557 amino acids from the C-terminal region of human DVL3. |
Rabbit Polyclonal Dishevelled 3 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Anti-DVL2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DVL2 antibody: synthetic peptide directed towards the N terminal of human DVL2. Synthetic peptide located within the following region: AGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPA |
Dishevelled 2 (DVL2) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 587-617 amino acids from the C-terminal region of Human DVL2. |
Transient overexpression lysate of dishevelled, dsh homolog 1 (Drosophila) (DVL1), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal anti-DVL2 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human DVL2. |
Rabbit polyclonal anti-Dvl3 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 583 of mouse Dvl3 |
Rabbit Polyclonal Anti-DVL2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-DVL2 antibody is: synthetic peptide directed towards the middle region of Human DVL2. Synthetic peptide located within the following region: HRTGGPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQ |
Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI7A3 (formerly 7A3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI7C7 (formerly 7C7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI1B12 (formerly 1B12)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) DVL2 mouse monoclonal antibody, clone OTI2E11 (formerly 2E11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI7F10 (formerly 7F10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DVL1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-DVL2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DVL2 |
DVL2 mouse monoclonal antibody, clone OTI7A3 (formerly 7A3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
DVL2 mouse monoclonal antibody, clone OTI7A3 (formerly 7A3), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
DVL2 mouse monoclonal antibody, clone OTI7A3 (formerly 7A3), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
DVL2 mouse monoclonal antibody, clone OTI7A3 (formerly 7A3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |