Research Areas

cDNA Clones (34)
Antibodies (26)
Proteins (20)
Jump to Filters
View as table Download
ROR alpha (RORA) (NM_134261) Human Tagged ORF Clone
RC202926

USD 480.00

In Stock

RORA (Myc-DDK-tagged)-Human RAR-related orphan receptor A (RORA), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ROR alpha (RORA) (NM_134262) Human Tagged ORF Clone
RC220656

USD 420.00

In Stock

RORA (Myc-DDK-tagged)-Human RAR-related orphan receptor A (RORA), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ROR alpha (RORA) (NM_134261) Human Untagged Clone
SC123126

USD 310.00

In Stock

RORA (untagged)-Human RAR-related orphan receptor A (RORA), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ROR alpha (RORA) (NM_002943) Human Tagged ORF Clone
RC214618

USD 480.00

In Stock

RORA (Myc-DDK-tagged)-Human RAR-related orphan receptor A (RORA), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ROR alpha (RORA) (NM_134260) Human Tagged ORF Clone
RC216664

USD 520.00

In Stock

RORA (Myc-DDK-tagged)-Human RAR-related orphan receptor A (RORA), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ROR alpha (RORA) (NM_134261) Human Tagged ORF Clone
RG202926

USD 530.00

In Stock

RORA (GFP-tagged) - Human RAR-related orphan receptor A (RORA), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ROR alpha (RORA) (NM_002943) Human Tagged ORF Clone
RG214618

USD 530.00

In Stock

RORA (GFP-tagged) - Human RAR-related orphan receptor A (RORA), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ROR alpha (RORA) (NM_134261) Human Tagged ORF Clone
RC202926L3

USD 680.00

3 Weeks

Lenti ORF clone of Human RAR-related orphan receptor A (RORA), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ROR alpha (RORA) (NM_134261) Human Tagged ORF Clone Lentiviral Particle
RC202926L3V

USD 880.00

5 Weeks

Lenti ORF particles, RORA (Myc-DDK tagged) - Human RAR-related orphan receptor A (RORA), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ROR alpha (RORA) (NM_134261) Human Tagged ORF Clone
RC202926L4

USD 680.00

3 Weeks

Lenti ORF clone of Human RAR-related orphan receptor A (RORA), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ROR alpha (RORA) (NM_134261) Human Tagged ORF Clone Lentiviral Particle
RC202926L4V

USD 880.00

7 Weeks

Lenti ORF particles, RORA (mGFP-tagged) - Human RAR-related orphan receptor A (RORA), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ROR alpha (RORA) (NM_002943) Human Tagged ORF Clone
RC214618L3

USD 680.00

3 Weeks

Lenti-ORF clone of RORA (Myc-DDK-tagged)-Human RAR-related orphan receptor A (RORA), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ROR alpha (RORA) (NM_002943) Human Tagged ORF Clone Lentiviral Particle
RC214618L3V

USD 880.00

6 Weeks

Lenti ORF particles, RORA (Myc-DDK-tagged)-Human RAR-related orphan receptor A (RORA), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ROR alpha (RORA) (NM_002943) Human Tagged ORF Clone
RC214618L4

USD 680.00

3 Weeks

Lenti-ORF clone of RORA (mGFP-tagged)-Human RAR-related orphan receptor A (RORA), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ROR alpha (RORA) (NM_134260) Human Tagged ORF Clone
RC216664L3

USD 720.00

3 Weeks

Lenti ORF clone of Human RAR-related orphan receptor A (RORA), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ROR alpha (RORA) (NM_134260) Human Tagged ORF Clone Lentiviral Particle
RC216664L3V

USD 920.00

6 Weeks

Lenti ORF particles, RORA (Myc-DDK tagged) - Human RAR-related orphan receptor A (RORA), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ROR alpha (RORA) (NM_134260) Human Tagged ORF Clone
RC216664L4

USD 720.00

3 Weeks

Lenti ORF clone of Human RAR-related orphan receptor A (RORA), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ROR alpha (RORA) (NM_134260) Human Tagged ORF Clone Lentiviral Particle
RC216664L4V

USD 920.00

6 Weeks

Lenti ORF particles, RORA (mGFP-tagged) - Human RAR-related orphan receptor A (RORA), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ROR alpha (RORA) (NM_134262) Human Tagged ORF Clone
RC220656L3

USD 620.00

3 Weeks

Lenti ORF clone of Human RAR-related orphan receptor A (RORA), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ROR alpha (RORA) (NM_134262) Human Tagged ORF Clone Lentiviral Particle
RC220656L3V

USD 820.00

5 Weeks

Lenti ORF particles, RORA (Myc-DDK tagged) - Human RAR-related orphan receptor A (RORA), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ROR alpha (RORA) (NM_134262) Human Tagged ORF Clone
RC220656L4

USD 620.00

3 Weeks

Lenti ORF clone of Human RAR-related orphan receptor A (RORA), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ROR alpha (RORA) (NM_134262) Human Tagged ORF Clone Lentiviral Particle
RC220656L4V

USD 820.00

7 Weeks

Lenti ORF particles, RORA (mGFP-tagged) - Human RAR-related orphan receptor A (RORA), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ROR alpha (RORA) (NM_134260) Human Tagged ORF Clone
RG216664

USD 570.00

3 Weeks

RORA (GFP-tagged) - Human RAR-related orphan receptor A (RORA), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ROR alpha (RORA) (NM_134262) Human Tagged ORF Clone
RG220656

USD 460.00

3 Weeks

RORA (GFP-tagged) - Human RAR-related orphan receptor A (RORA), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ROR alpha (RORA) (NM_134261) Human Over-expression Lysate
LY403350

USD 396.00

2 Weeks

Transient overexpression lysate of RAR-related orphan receptor A (RORA), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ROR alpha (RORA) (NM_134262) Human Untagged Clone
SC305981

USD 760.00

In Stock

RORA (untagged)-Human RAR-related orphan receptor A (RORA), transcript variant 4

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ROR alpha (RORA) (NM_134261) Human Over-expression Lysate
LC403350

USD 121.00

In Stock

RORA HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ROR alpha (RORA) (NM_134260) Human Untagged Clone
SC305980

USD 950.00

In Stock

RORA (untagged)-Human RAR-related orphan receptor A (RORA), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ROR alpha (RORA) (NM_002943) Human Untagged Clone
SC109741

USD 920.00

In Stock

RORA (untagged)-Human RAR-related orphan receptor A (RORA), transcript variant 3

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SC109741 is the updated version of SC109742.
ROR alpha (RORA) Rabbit Polyclonal Antibody
TA314450

USD 345.00

4 Weeks

Rabbit polyclonal anti-RORA antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human RORA.
ROR alpha (RORA) (NM_002943) Human Over-expression Lysate
LY401041

USD 605.00

In Stock

Transient overexpression lysate of RAR-related orphan receptor A (RORA), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ROR alpha (RORA) (NM_134262) Human Over-expression Lysate
LY408623

USD 605.00

5 Days

Transient overexpression lysate of RAR-related orphan receptor A (RORA), transcript variant 4

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ROR alpha (RORA) (NM_134261) Human Tagged ORF Clone
RC202926L2

USD 680.00

3 Weeks

Lenti ORF clone of Human RAR-related orphan receptor A (RORA), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ROR alpha (RORA) (NM_134262) Human Tagged ORF Clone
RC220656L2

USD 620.00

3 Weeks

Lenti ORF clone of Human RAR-related orphan receptor A (RORA), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ROR alpha (RORA) Rabbit Polyclonal Antibody
TA337925

USD 310.00

5 Days

Rabbit Polyclonal Anti-RORA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORA antibody: synthetic peptide directed towards the middle region of human RORA. Synthetic peptide located within the following region: GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP
ROR alpha (RORA) (NM_002943) Human Over-expression Lysate
LC401041

USD 187.00

In Stock

RORA HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
ROR alpha (RORA) Rabbit Polyclonal Antibody
TA324372

USD 450.00

5 Days

Rabbit polyclonal RORA Antibody (T216)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This RORA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 193-222 amino acids from human RORA.
ROR alpha (RORA) Rabbit Polyclonal Antibody
TA330071

USD 310.00

5 Days

Rabbit Polyclonal Anti-RORA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORA antibody: synthetic peptide directed towards the N terminal of human RORA. Synthetic peptide located within the following region: FGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYSQKEDKEVQTGYMNA
ROR alpha (RORA) Rabbit Polyclonal Antibody
TA330070

USD 375.00

5 Days

Rabbit Polyclonal Anti-RORA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORA antibody: synthetic peptide directed towards the N terminal of human RORA. Synthetic peptide located within the following region: ARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEIIPCKICGDKSSGIHY
ROR alpha (RORA) Rabbit Polyclonal Antibody
TA337922

USD 375.00

5 Days

Rabbit Polyclonal Anti-Rora Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Rora antibody is synthetic peptide directed towards the middle region of Mouse Rora. Synthetic peptide located within the following region: STYMDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPA
ROR alpha (RORA) Rabbit Polyclonal Antibody
TA337923

USD 375.00

5 Days

Rabbit Polyclonal Anti-RORA Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RORA antibody: synthetic peptide directed towards the middle region of human RORA. Synthetic peptide located within the following region: GFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFK
ROR alpha (RORA) Rabbit Polyclonal Antibody
TA337924

USD 375.00

5 Days

Rabbit Polyclonal Anti-RORA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORA antibody: synthetic peptide directed towards the N terminal of human RORA. Synthetic peptide located within the following region: ARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEIIPCKICGDKSSGIHY
ROR alpha (RORA) Rabbit Polyclonal Antibody
TA338250

USD 310.00

5 Days

Rabbit Polyclonal Anti-RORA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORA antibody: synthetic peptide directed towards the N terminal of human RORA. Synthetic peptide located within the following region: CGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRC
ROR alpha (RORA) Rabbit Polyclonal Antibody
TA338251

USD 375.00

5 Days

Rabbit Polyclonal Anti-RORA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORA antibody: synthetic peptide directed towards the middle region of human RORA. Synthetic peptide located within the following region: PGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDI