Research Areas

cDNA Clones (9)
Proteins (6)
Antibodies (1)
Jump to Filters
View as table Download
IL33 (NM_033439) Human Tagged ORF Clone
RC207989

USD 420.00

In Stock

IL33 (Myc-DDK-tagged)-Human interleukin 33 (IL33), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
IL33 (NM_033439) Human Untagged Clone
SC100114

USD 310.00

In Stock

IL33 (untagged)-Human interleukin 33 (IL33), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
IL33 (NM_033439) Human Tagged ORF Clone
RG207989

USD 460.00

In Stock

IL33 (GFP-tagged) - Human interleukin 33 (IL33), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
IL33 (NM_001199641) Human Tagged ORF Clone
RC231815

USD 420.00

3 Weeks

IL33 (Myc-DDK tagged) - Homo sapiens interleukin 33 (IL33), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
IL33 (NM_001199640) Human Tagged ORF Clone
RC232205

USD 420.00

3 Weeks

IL33 (Myc-DDK tagged) - Homo sapiens interleukin 33 (IL33), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
IL33 (NM_001199641) Human Tagged ORF Clone
RG231815

USD 460.00

3 Weeks

IL33 (GFP-tagged) - Homo sapiens interleukin 33 (IL33), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
IL33 (NM_001199640) Human Tagged ORF Clone
RG232205

USD 460.00

3 Weeks

IL33 (GFP-tagged) - Homo sapiens interleukin 33 (IL33), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
IL33 Rabbit Polyclonal Antibody
TA339875

USD 375.00

5 Days

Rabbit Polyclonal Anti-IL33 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL33 antibody: synthetic peptide directed towards the N terminal of human IL33. Synthetic peptide located within the following region: AKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAAC
IL33 (NM_001199640) Human Untagged Clone
SC329543

USD 310.00

3 Weeks

IL33 (untagged) - Homo sapiens interleukin 33 (IL33), transcript variant 2

Vector pCMV6 series
Tag Tag Free
IL33 (NM_001199641) Human Untagged Clone
SC329544

USD 310.00

3 Weeks

IL33 (untagged) - Homo sapiens interleukin 33 (IL33), transcript variant 3

Vector pCMV6 series
Tag Tag Free
IL33 (NM_033439) Human Recombinant Protein
TP720207L

USD 1,900.00

3 Weeks

Recombinant protein of human interleukin 33 (IL33)

Tag N-His
Expression Host E. coli
IL33 (NM_033439) Human Recombinant Protein
TP720207M

USD 760.00

3 Weeks

Recombinant protein of human interleukin 33 (IL33)

Tag N-His
Expression Host E. coli
IL33 (NM_033439) Human Recombinant Protein
TP720207XL

USD 2,800.00

3 Weeks

Recombinant protein of human interleukin 33 (IL33)

Tag N-His
Expression Host E. coli
IL33 (NM_033439) Human Recombinant Protein
TP720601L

USD 1,900.00

3 Weeks

Purified recombinant protein of Human interleukin 33 (IL33), transcript variant 1

Tag N-Avi
Expression Host E. coli
IL33 (NM_033439) Human Recombinant Protein
TP720601M

USD 760.00

3 Weeks

Purified recombinant protein of Human interleukin 33 (IL33), transcript variant 1

Tag N-Avi
Expression Host E. coli
IL33 Cytosection
TS407989P5

USD 889.00

4 Weeks

Transient overexpression of IL33 (NM_033439) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack