Germany
Japan
United Kingdom
China
IL33 (Myc-DDK-tagged)-Human interleukin 33 (IL33), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Research Areas
View as table Download
IL33 (untagged)-Human interleukin 33 (IL33), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Il33 (Myc-DDK-tagged) - Mouse interleukin 33 (Il33), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL33 (GFP-tagged) - Human interleukin 33 (IL33), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Il33 (Myc-DDK-tagged) - Mouse interleukin 33 (Il33), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Il33 (untagged) - Mouse interleukin 33 (cDNA clone MGC:6424 IMAGE:3593927), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Il33 (GFP-tagged) - Mouse interleukin 33 (Il33)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Il33 (Myc-DDK-tagged ORF) - Rat interleukin 33 (Il33), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Il33 (GFP-tagged) - Mouse interleukin 33 (Il33) transcript variant 2, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL33 (Myc-DDK tagged) - Homo sapiens interleukin 33 (IL33), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL33 (Myc-DDK tagged) - Homo sapiens interleukin 33 (IL33), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL33 (GFP-tagged) - Homo sapiens interleukin 33 (IL33), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL33 (GFP-tagged) - Homo sapiens interleukin 33 (IL33), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Il33 (untagged ORF) - Rat interleukin 33 (Il33), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of interleukin 33 (IL33) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Rabbit Polyclonal Anti-IL33 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL33 antibody: synthetic peptide directed towards the N terminal of human IL33. Synthetic peptide located within the following region: AKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAAC |
IL33 (untagged) - Homo sapiens interleukin 33 (IL33), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
IL33 (untagged) - Homo sapiens interleukin 33 (IL33), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
IL33 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human IL33 |
Recombinant protein of human interleukin 33 (IL33)
| Tag | N-His |
| Expression Host | E. coli |
Recombinant protein of human interleukin 33 (IL33)
| Tag | N-His |
| Expression Host | E. coli |
Recombinant protein of human interleukin 33 (IL33)
| Tag | N-His |
| Expression Host | E. coli |
Purified recombinant protein of Human interleukin 33 (IL33), transcript variant 1
| Tag | N-Avi |
| Expression Host | E. coli |
Purified recombinant protein of Human interleukin 33 (IL33), transcript variant 1
| Tag | N-Avi |
| Expression Host | E. coli |
Purified recombinant protein of Mouse interleukin 33 (Il33), transcript variant 1
| Tag | tag free |
| Expression Host | E. coli |
Purified recombinant protein of Mouse interleukin 33 (Il33), transcript variant 1
| Tag | tag free |
| Expression Host | E. coli |
Purified recombinant protein of Mouse interleukin 33 (Il33), transcript variant 1
| Tag | tag free |
| Expression Host | E. coli |
Transient overexpression of IL33 (NM_033439) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- IL33