Research Areas

View as table Download

WNT16 (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

WNT16 (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, WNT16 (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, WNT16 (mGFP-tagged) - Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, WNT16 (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, WNT16 (mGFP-tagged) - Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

WNT16 (GFP-tagged) - Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

WNT16 (GFP-tagged) - Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, WNT16 (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, WNT16 (mGFP-tagged) - Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, WNT16 (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, WNT16 (mGFP-tagged) - Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

WNT16 (untagged)-Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-WNT16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT16 antibody: synthetic peptide directed towards the middle region of human WNT16. Synthetic peptide located within the following region: KTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECN

Rabbit Polyclonal Anti-WNT16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT16 antibody: synthetic peptide directed towards the C terminal of human WNT16. Synthetic peptide located within the following region: REKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSEGADG

Lenti ORF clone of Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

WNT16 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit polyclonal WNT16 Antibody (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This WNT16 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-265 amino acids from the C-terminal region of human WNT16.

Rabbit Polyclonal Anti-WNT16 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen WNT16 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT16. Percent identity with other species by BLAST analysis: Human, Mouse, Rat, Hamster (100%); Gorilla, Monkey, Marmoset (94%); Gibbon, Elephant, Panda, Dog, Horse, Turkey (88%); Bovine, Rabbit, Opossum, Platypus (81%).

Rabbit Polyclonal Anti-WNT16 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen WNT16 antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT16. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Bovine, Horse (93%); Hamster, Elephant, Pig (87%); Mouse, Rat, Panda, Dog, Bat, Rabbit, Lizard (80%).

WNT16 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

WNT16 MS Standard C13 and N15-labeled recombinant protein (NP_476509)

Tag C-Myc/DDK
Expression Host HEK293

WNT16 (untagged)-Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Transient overexpression of WNT16 (NM_057168) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of WNT16 (NM_016087) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of WNT16 (NM_057168) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of WNT16 (NM_057168) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of WNT16 (NM_016087) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of WNT16 (NM_016087) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack