Germany
Japan
United Kingdom
China
WNT16 (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Research Areas
View as table Download
WNT16 (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Wnt16 (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 16 (Wnt16)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Purified recombinant protein of Homo sapiens wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, WNT16 (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, WNT16 (mGFP-tagged) - Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, WNT16 (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, WNT16 (mGFP-tagged) - Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Wnt16 (GFP-tagged) - Mouse wingless-related MMTV integration site 16 (Wnt16), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
WNT16 (GFP-tagged) - Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
WNT16 (GFP-tagged) - Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
WNT16 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN411204 is the updated version of KN211204.
Wnt16 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN519449 is the updated version of KN319449.
Lenti ORF clone of Wnt16 (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 16 (Wnt16)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Wnt16 (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 16 (Wnt16), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Wnt16 (mGFP-tagged) - Mouse wingless-related MMTV integration site 16 (Wnt16)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Wnt16 (GFP-tagged) - Mouse wingless-related MMTV integration site 16 (Wnt16), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, WNT16 (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, WNT16 (mGFP-tagged) - Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, WNT16 (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, WNT16 (mGFP-tagged) - Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Wnt16 (Myc-DDK-tagged ORF) - Rat wingless-type MMTV integration site family, member 16 (Wnt16), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Wnt16 (Myc-DDK-tagged ORF) - Rat wingless-type MMTV integration site family, member 16 (Wnt16), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Wnt16 (Myc-DDK-tagged ORF) - Rat wingless-type MMTV integration site family, member 16 (Wnt16), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Wnt16 (mGFP-tagged ORF) - Rat wingless-type MMTV integration site family, member 16 (Wnt16), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Wnt16 (GFP-tagged ORF) - Rat wingless-type MMTV integration site family, member 16 (Wnt16), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Wnt16 (untagged) - Mouse wingless-related MMTV integration site 16 (Wnt16), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
WNT16 (untagged)-Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Wnt16 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Rabbit Polyclonal Anti-WNT16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT16 antibody: synthetic peptide directed towards the middle region of human WNT16. Synthetic peptide located within the following region: KTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECN |
Rabbit Polyclonal Anti-WNT16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT16 antibody: synthetic peptide directed towards the C terminal of human WNT16. Synthetic peptide located within the following region: REKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSEGADG |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
WNT16 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Transient overexpression lysate of wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit polyclonal WNT16 Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This WNT16 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-265 amino acids from the C-terminal region of human WNT16. |
Rabbit Polyclonal Anti-WNT16 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | WNT16 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT16. Percent identity with other species by BLAST analysis: Human, Mouse, Rat, Hamster (100%); Gorilla, Monkey, Marmoset (94%); Gibbon, Elephant, Panda, Dog, Horse, Turkey (88%); Bovine, Rabbit, Opossum, Platypus (81%). |
Rabbit Polyclonal Anti-WNT16 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | WNT16 antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT16. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Bovine, Horse (93%); Hamster, Elephant, Pig (87%); Mouse, Rat, Panda, Dog, Bat, Rabbit, Lizard (80%). |
WNT16 CRISPRa kit - CRISPR gene activation of human Wnt family member 16
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Wnt16 CRISPRa kit - CRISPR gene activation of mouse wingless-type MMTV integration site family, member 16
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene WNT16
WNT16 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qSTAR qPCR primer pairs against Mus musculus gene Wnt16
WNT16 MS Standard C13 and N15-labeled recombinant protein (NP_476509)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Wnt16 (untagged ORF) - Rat wingless-type MMTV integration site family, member 16 (Wnt16), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
WNT16 (untagged)-Human wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Active filters
Target Symbol
- WNT16