Germany
Japan
United Kingdom
China
WNT5A (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 5A (WNT5A)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Research Areas
View as table Download
WNT5A (untagged)-Human wingless-type MMTV integration site family, member 5A (WNT5A)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Recombinant protein of human wingless-type MMTV integration site family, member 5A (WNT5A)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Wnt5a (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 5A (Wnt5a)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, WNT5A (mGFP-tagged) - Human wingless-type MMTV integration site family, member 5A (WNT5A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, WNT5A (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 5A (WNT5A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
WNT5A (GFP-tagged) - Human wingless-type MMTV integration site family, member 5A (WNT5A)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
WNT5A - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN409206 is the updated version of KN209206.
Wnt5a - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN519455 is the updated version of KN319455.
Wnt5a (GFP-tagged) - Mouse wingless-related MMTV integration site 5A (Wnt5a)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, Wnt5a (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 5A (Wnt5a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, Wnt5a (GFP-tagged) - Mouse wingless-related MMTV integration site 5A (Wnt5a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Wnt5a (myc-DDK-tagged) - Mouse wingless-type MMTV integration site family, member 5A (Wnt5a), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, WNT5A (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 5A (WNT5A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human wingless-type MMTV integration site family, member 5A (WNT5A), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, WNT5A (mGFP-tagged) - Human wingless-type MMTV integration site family, member 5A (WNT5A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
WNT5A (Myc-DDK tagged) - Homo sapiens wingless-type MMTV integration site family, member 5A (WNT5A), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
WNT5A (GFP-tagged) - Homo sapiens wingless-type MMTV integration site family, member 5A (WNT5A), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Wnt5a (Myc-DDK-tagged ORF) - Rat wingless-type MMTV integration site family, member 5A (Wnt5a), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Wnt5a (Myc-DDK-tagged ORF) - Rat wingless-type MMTV integration site family, member 5A (Wnt5a), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Wnt5a (Myc-DDK-tagged ORF) - Rat wingless-type MMTV integration site family, member 5A (Wnt5a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Wnt5a (mGFP-tagged ORF) - Rat wingless-type MMTV integration site family, member 5A (Wnt5a), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Wnt5a (GFP-tagged ORF) - Rat wingless-type MMTV integration site family, member 5A (Wnt5a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
WNT5A (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
WNT5A - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
WNT5A - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Wnt5a (untagged) - Mouse wingless-related MMTV integration site 5A (Wnt5a), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
WNT5A - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
WNT5A - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Transient overexpression lysate of wingless-type MMTV integration site family, member 5A (WNT5A)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-WNT5A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT |
WNT5A - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
WNT5A HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 5A (WNT5A), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Wnt5a (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Anti-WNT5A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 280 amino acids of human wingless-type MMTV integration site family, member 5A |
Rabbit Polyclonal Wnt-5a Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids 190-230 of human Wnt5A was used as the immunogen for this antibody, GenBank no NP_003383.2. |
Wnt5a - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
qSTAR qPCR primer pairs against Homo sapiens gene WNT5A
Wnt5a - mouse gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
qSTAR qPCR primer pairs against Mus musculus gene Wnt5a
Mouse Monoclonal Wnt-5a Antibody (4M5E4)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
WNT5A - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
Wnt5a - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
WNT5A CRISPRa kit - CRISPR gene activation of human Wnt family member 5A
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Wnt5a CRISPRa kit - CRISPR gene activation of mouse wingless-type MMTV integration site family, member 5A
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene WNT5A
| Application | Plasmid of exact quantity for transcript copy number calculation |
WNT5A - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | mBFP-Neo |
WNT5A - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | Luciferase-Puro |
Active filters
Target Symbol
- WNT5A