Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-Maf Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Maf Antibody: A synthesized peptide derived from human Maf |
Products
View as table Download
Rabbit polyclonal anti-Maf antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human Maf. |
Rabbit Polyclonal Anti-MAF Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MAF antibody is: synthetic peptide directed towards the C-terminal region of Human MAF. Synthetic peptide located within the following region: DAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWK |
c Maf (MAF) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Anti-MAF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAF antibody: synthetic peptide directed towards the middle region of human MAF. Synthetic peptide located within the following region: LQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFI |
Rabbit Polyclonal Anti-MAF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAF antibody: synthetic peptide directed towards the N terminal of human MAF. Synthetic peptide located within the following region: MASELAMSNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLI |
MAF Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse MAF |
c-Maf Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 314-403 of human c-Maf (NP_005351.2). |
| Modifications | Unmodified |
c-Maf Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 314-403 of human c-Maf (NP_005351.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- MAF
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal