Products

View as table Download

DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3

DiMethyl-Histone H3-K36 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3

Symmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3

Rabbit Polyclonal H3K9/14ac Antibody

Applications Dot, ELISA, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K9/14ac antibody: histone H3 acetylated at lysines 9 and 14 (H3K9/14ac), using a KLH-conjugated synthetic peptide.

MonoMethyl-Histone H3-K27 Rabbit Polyclonal Antibody

Applications ChIP, Dot, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K27 of human histone H3

TriMethyl-Histone H3-K79 Rabbit Polyclonal Antibody

Applications ChIP, Dot, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K79 of human histone H3

Rabbit Polyclonal H3K9me2 Antibody

Applications Dot, ELISA, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K9me2 antibody: the region of histone H3 containing the dimethylated lysine 9 (H3K9me2), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K27me3S28p Antibody

Applications Dot, ELISA, IF, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K27me3S28p antibody: histone H3 containing the trimethylated lysine 27 and the phosphorylated serine 28 (H3K27me3S28p), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3S10p Antibody

Applications Dot, ELISA, IF, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3S10p antibody: histone H3 containing the phosphorylated serine 10 (H3S10p), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K27me3 Antibody

Applications Dot, ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K27me3 antibody: against histone H3, trimethylated at lysine 27 (H3K27me3), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K36me2 Antibody

Applications Dot, ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K36me2 antibody: histone H3 containing the dimethylated lysine 36 (H3K36me2), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K9ac Antibody

Applications Dot, ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K9ac antibody: histone H3, acetylated at lysine 9 (H3K9ac), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K4me2 Antibody

Applications Dot, ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K4me2 antibody: histone H3 containing the dimethylated lysine 4 (H3K4me2), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K79me2 Antibody

Applications Dot, ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K79me2 antibody: the region of histone H3 containing the dimethylated lysine 79 (H3K79me2), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K18ac Antibody

Applications Dot, ELISA, IF, WB
Reactivities Human, Mouse, Broad
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K18ac antibody: the region of histone H3 containing the acetylated lysine 18 (H3K18ac), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3R17me2(asym)K18ac Antibody

Applications Dot, ELISA, IF, WB
Reactivities Human, Mouse, Broad
Conjugation Unconjugated
Immunogen The immunogen for anti-H3R17me2(asym)K18ac antibody: the region of histone H3 containing the asymmetrically dimethylated R17 and the acetylated lysine 18 (H3R17me2(asym)K18ac), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H4K5,8,12ac Antibody

Applications Dot, ELISA, IF, WB
Reactivities Human, Mouse, Broad
Conjugation Unconjugated
Immunogen The immunogen for anti-H4K5,8,12ac antibody: the region of histone H4 containing the acetylated lysines 5, 8 and 12 (H4K5,8,12ac), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H4K20me3 Antibody

Applications Dot, ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H4K20me3 antibody: the region of histone H4 containing the trimethylated lysine 20 (H4K20me3), using a KLH-conjugated synthetic peptide.

Rabbit anti-Histone H4K20me2 Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K20 of human histone H4

Rabbit Polyclonal H3K9me1 Antibody

Applications Dot, ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K9me1 antibody: histone H3 containing the monomethylated lysine 9 (H3K9me1), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K9acS10p Antibody

Applications Dot, ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K9acS10p antibody: histone H3 containing the acetylated lysine 9 and the phosphorylated serine 10 (H3K9acS10p), using a KLH-conjugated synthetic peptide

Rabbit Polyclonal H3K9me3S10p Antibody

Applications Dot, ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K9me3S10p antibody: histone H3 containing trimethylated lysine 9 and the phosphorylated serine 10 (H3K9me3S10p), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K4me1 Antibody

Applications Dot, ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K4me1 antibody: histone H3 containing the monomethylated lysine 4 (H3K4me1), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K27me1 Antibody

Applications Dot, ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K27me1 antibody: histone H3 containing the monomethylated lysine 27 (H3K27me1), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K27me2 Antibody

Applications Dot, ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K27me2 antibody: the histone H3, dimethylated at lysine 27 (H3K27me2), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K9me3 Antibody

Applications Dot, ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K9me3 antibody: the region of histone H3 containing the trimethylated lysine 9 (H3K9me3), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K36me1 Antibody

Applications Dot, ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K36me1 antibody: histone H3 containing the monomethylated lysine 36 (H3K36me1), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3S10p Antibody

Applications Dot, ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3S10p antibody: histone H3 containing the phosphorylated serine 10 (H3S10p), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal Anti-IFNG Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human IFNG

Rabbit Polyclonal H2A.Zac Antibody

Applications Dot, ELISA, IF
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H2A.Zac antibody: histone H2A.Z acetylated at lysines 5, 7 and 11, using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H2BK12ac Antibody

Applications Dot, ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H2BK12ac antibody: the region of histone H2B containing the acetylated lysine 12 (H2BK12ac), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H2BK15ac Antibody

Applications Dot, ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H2BK15ac antibody: the region of histone H2B containing the acetylated lysine 15 (H2BK15ac), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K36me3 Antibody

Applications Dot, ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K36me3 antibody: histone H3 containing the trimethylated lysine 36 (H3K36me3), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K4me3 Antibody

Applications Dot, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K4me3 antibody: the region of histone H3 containing the trimethylated lysine 4 (H3K4me3), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K36me3 Antibody

Applications Dot, ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K36me3 antibody: histone H3, trimethylated at lysine 36 (H3K36me3), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K79me3 Antibody

Applications Dot, ELISA, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K79me3 antibody: histone H3 containing the trimethylated lysine 79 (H3K79me3), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K79me1 Antibody

Applications Dot, ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K79me1 antibody: histone H3 containing the monomethylated lysine 79 (H3K79me1), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H2AK5ac Antibody

Applications Dot, ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H2AK5ac antibody: the region of histone H2A containing the acetylated lysine 5 (H2AK5ac), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H4K5,8,12,16ac Antibody

Applications Dot, ELISA, IF
Reactivities Human, Mouse, Broad
Conjugation Unconjugated
Immunogen The immunogen for anti-H4K5,8,12,16ac antibody: the region of histone H4 containing the acetylated lysines 5, 8, 12 and 16 (H4K5,8,12,16ac), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H4K5ac Antibody

Applications Dot, ELISA, WB
Reactivities Human, Mouse, Broad
Conjugation Unconjugated
Immunogen The immunogen for anti-H4K5ac antibody: the region of histone H4 containing the acetylated lysine 5 (H4K5ac), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ

Rabbit Polyclonal H3K4me2 Antibody

Applications Dot, ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K4me2 antibody: histone H3 containing the dimethylated lysine 4 (H3K4me2), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K4me1 Antibody

Applications Dot, ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K4me1 antibody: histone H3 containing the monomethylated lysine 4 (H3K4me1), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H4K8ac Antibody

Applications Dot, ELISA, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-H4K8ac antibody: the region of histone H4 containing the acetylated lysine 8 (H4K8ac), using a KLH-conjugated synthetic peptide.

Rabbit Anti-NMDA NR2B Subunit Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein from the C-terminal region of the NR2B subunit

Rabbit anti-Histone H3K9me3 Polyclonal Antibody

Applications ChIP, Dot, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K9 of human histone H3

Rabbit Polyclonal H3K4me3 Antibody

Applications Dot, ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K4me3 antibody: the region of histone H3 containing the trimethylated lysine 4 (H3K4me3), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K79me2 Antibody

Applications Dot, ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K79me2 antibody: histone H3 containing the dimethylated lysine 79 (H3K79me2), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K79me1 Antibody

Applications Dot, ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K79me1 antibody: histone H3 the monomethylated lysine 79 (H3K79me1), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3R17me2 Antibody

Applications Dot, ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3R17me2 antibody: histone H3 containing the asymmetrically dimethylated arginine 17 (H3R17me2(asym)), using a KLH-conjugated synthetic peptide.