Products

View as table Download

NMDAR2A (GRIN2A) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1291-1318 amino acids from the C-terminal region of Human NMDA Receptor 2A.

Rabbit polyclonal anti-SCN2B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SCN2B.

Rabbit polyclonal anti-SCN9A antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SCN9A.

Rabbit Polyclonal Anti-Human NaV1.5

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen GST fusion protein with amino acid residues 1978-2016 of human Nav1.5. Intracellular, C-terminus.

SCN1B (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 70-98 amino acids from the N-terminal region of Human SCN1B

Rabbit polyclonal SCN4B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SCN4B.

Rabbit polyclonal Anti-SCN3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCN3B antibody: synthetic peptide directed towards the N terminal of human SCN3B. Synthetic peptide located within the following region: RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND

Rabbit Polyclonal Anti-SCN9A Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen SCN9A / Nav1.7 antibody was raised against synthetic 17 amino acid peptide from internal region of human SCN9A / Nav1.7. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Mouse, Panda, Dog, Bovine, Horse, Rabbit, Pig (94%); Rat, Hamster, Bat (88%); Elephant, Platypus (82%).

Rabbit Polyclonal SCN3B Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

NMDAR2A (GRIN2A) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 1057-1084 amino acids from the Central region of Human NMDA Receptor 2A

Rabbit polyclonal Sodium Channel-pan antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human sodium channel.

Rabbit Polyclonal Anti-SCN5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCN5A antibody is: synthetic peptide directed towards the C-terminal region of Human SCN5A. Synthetic peptide located within the following region: VMSENFSRPLGPPSSSSISSTSFPPSYDSVTRATSDNLQVRGSDYSHSED

Rabbit Polyclonal Anti-GRIN2A Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST

Rabbit Polyclonal Anti-SCN5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCN5A antibody: synthetic peptide directed towards the C terminal of human SCN5A. Synthetic peptide located within the following region: FTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAM

Rabbit Polyclonal Anti-Scn1b Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Scn1b antibody is: synthetic peptide directed towards the N-terminal region of Rat Scn1b. Synthetic peptide located within the following region: TFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIF

SCN2A rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

SCN1B (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the N-terminal of human SCN1B

Rabbit Anti-NMDA NR2A Subunit Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein from the C-terminal region of the NR2A subunit

Rabbit Anti-NMDA NR2A Subunit Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein from the C-terminal region of the NR2A subunit

SCN3A / Nav1.3 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Chimpanzee, Human
Immunogen SCN3A / Nav1.3 antibody was raised against synthetic 18 amino acid peptide from internal region of human SCN3A / Nav1.3. Percent identity with other species by BLAST analysis: Human, Chimpanzee (100%); Monkey, Galago (94%); Orangutan, Gibbon, Marmoset, Mouse, Bovine, Guinea pig (89%); Rat, Hamster, Panda, Dog (83%).

Rabbit Polyclonal Anti-SCN5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCN5A antibody: synthetic peptide directed towards the N terminal of human SCN5A. Synthetic peptide located within the following region: SEADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQPSPGTSAPGHALH

Rabbit Polyclonal Anti-SCN1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCN1B antibody: synthetic peptide directed towards the middle region of human SCN1B. Synthetic peptide located within the following region: NVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVS

Rabbit Polyclonal Anti-SCN8A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCN8A antibody: synthetic peptide directed towards the middle region of human SCN8A. Synthetic peptide located within the following region: ESDPEGSKDKLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGC

Anti-SCN5A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1860-1874 amino acids of human sodium channel, voltage-gated, type V, alpha subunit

Anti-SCN5A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1860-1874 amino acids of human sodium channel, voltage-gated, type V, alpha subunit

Anti-SCN2A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 30-43 amino acids of human sodium channel, voltage-gated, type II, alpha subunit

Anti-SCN2A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 30-43 amino acids of human sodium channel, voltage-gated, type II, alpha subunit

Anti-SCN1A/2A/3A/4A/5A/8A/9A/10A/11A/12A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1503-1520 amino acids of human sodium channel, voltage-gated, type XI, alpha subunit

Anti-SCN1A/2A/3A/4A/5A/8A/9A/10A/11A/13A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1503-1520 amino acids of human sodium channel, voltage-gated, type XI, alpha subunit

Anti-SCN11A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 29-41 amino acids of human sodium channel, voltage-gated, type XI, alpha subunit

Anti-SCN11A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 29-41 amino acids of human sodium channel, voltage-gated, type XI, alpha subunit

Anti-SCN10A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 31-45 amino acids of human sodium channel, voltage-gated, type X, alpha subunit

Anti-SCN10A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 31-45 amino acids of human sodium channel, voltage-gated, type X, alpha subunit

Anti-SCN9A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 25-38 amino acids of human sodium channel, voltage-gated, type IX, alpha subunit

Anti-SCN9A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 25-38 amino acids of human sodium channel, voltage-gated, type IX, alpha subunit

Rabbit Polyclonal Anti-GRIN2A Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GRIN2A

Rabbit Polyclonal Anti-SCN1B Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SCN1B

Rabbit Polyclonal Anti-SCN9A Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SCN9A

Rabbit Polyclonal anti-GRIN2A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GRIN2A

Rabbit Polyclonal anti-GRIN2A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GRIN2A