Products

View as table Download

Rabbit Polyclonal HIF-2 alpha Antibody

Applications IHC, WB
Reactivities Fish, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A peptide derived from the C-terminus of mouse/human HIF-2 alpha protein.

Rabbit Polyclonal anti-CALR Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep
Conjugation Unconjugated
Immunogen Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH

Rabbit polyclonal anti-ATR antibody

Applications WB
Reactivities Fish, Human, Monkey, Mouse, Rat, Xenopus, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human ATR protein.

Rabbit Polyclonal Anti-OMA1 Antibody

Applications WB
Reactivities Fish, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OMA1 antibody: synthetic peptide directed towards the middle region of human OMA1. Synthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA

Rabbit polyclonal anti-PCNA antibody

Applications WB
Reactivities Bovine, Chicken, Fish, Human, Monkey, Mouse, Rat, Xenopus, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human PCNA protein.

Rabbit Polyclonal Anti-HSPA1L Antibody

Applications WB
Reactivities Human, Lamprey, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-HSPA1L Antibody: synthetic peptide directed towards the C terminal of human HSPA1L. Synthetic peptide located within the following region: DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD

Rabbit Polyclonal SOX2 Antibody

Applications WB
Reactivities Fish, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Reacts with residues 113-127 of the 37 kDa (predicted molecular weight is 34 kDa) human, mouse and rat SOX-2 protein. Sequence is 100% conserved in most species.

gamma Tubulin Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Chicken, Fish, Hamster, Human, Monkey, Mouse, Rat, Xenopus, Dog, Cow
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Tubulin gamma

Anti-Connexin 35/36 (Ser276) Antibody

Applications IHC, WB
Reactivities Fish, Mouse, Rabbit
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues of perch connexin 35/36 surrounding Ser276, conjugated to keyhole limpet hemocyanin (KLH).