Products

View as table Download

TCP1 beta (CCT2) (227-473) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 277 and 473 of Human TCP1 beta

Rabbit Polyclonal antibody to TCP1 beta (chaperonin containing TCP1, subunit 2 (beta))

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 277 and 503 of TCP1 beta (Uniprot ID#P78371)

Rabbit Polyclonal Anti-CCT2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CCT2 antibody is: synthetic peptide directed towards the middle region of CCT2. Synthetic peptide located within the following region: RVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGA

CCT2 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

TCP1 beta/CCT2 Rabbit polyclonal Antibody

Applications IF, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 206-535 of human TCP1 beta/TCP1 beta/CCT2 (NP_006422.1).
Modifications Unmodified