Products

View as table Download

Rabbit Polyclonal Anti-CDK8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDK8 antibody: synthetic peptide directed towards the C terminal of human CDK8. Synthetic peptide located within the following region: GLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY

Rabbit Polyclonal anti-RGD1560888 Antibody

Applications WB
Reactivities Rat
Immunogen The immunogen for Anti-RGD1560888 antibody is: synthetic peptide directed towards the N-terminal region of Rat RGD1560888. Synthetic peptide located within the following region: MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYA

Rabbit anti Cdk8 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide derived from C-terminus of human cdk8 protein. This sequence is identical to human, mouse and rat.

Rabbit Polyclonal Anti-CDK8 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CDK8

CDK8 Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 365-464 of human CDK8 (NP_001251.1).
Modifications Unmodified